KEGG   Danio rerio (zebrafish): 393586Help
Entry
393586            CDS       T01004                                 

Gene name
hsc70
Definition
(RefSeq) uncharacterized protein LOC393586
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03040  Spliceosome
dre04010  MAPK signaling pathway
dre04141  Protein processing in endoplasmic reticulum
dre04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    393586 (hsc70)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    393586 (hsc70)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    393586 (hsc70)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    393586 (hsc70)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dre01009]
    393586 (hsc70)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dre03041]
    393586 (hsc70)
   03009 Ribosome biogenesis [BR:dre03009]
    393586 (hsc70)
   03110 Chaperones and folding catalysts [BR:dre03110]
    393586 (hsc70)
   04131 Membrane trafficking [BR:dre04131]
    393586 (hsc70)
   03051 Proteasome [BR:dre03051]
    393586 (hsc70)
   03029 Mitochondrial biogenesis [BR:dre03029]
    393586 (hsc70)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    393586 (hsc70)
Protein phosphatases and associated proteins [BR:dre01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     393586 (hsc70)
Spliceosome [BR:dre03041]
 Complex B
  Other components
   Prp19 complex
    393586 (hsc70)
 Complex C
   Prp19-CDC5 complex
    393586 (hsc70)
Ribosome biogenesis [BR:dre03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    393586 (hsc70)
Chaperones and folding catalysts [BR:dre03110]
 Heat shock proteins
  HSP70 / DNAK
   393586 (hsc70)
Membrane trafficking [BR:dre04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    393586 (hsc70)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    393586 (hsc70)
Proteasome [BR:dre03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    393586 (hsc70)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    393586 (hsc70)
Exosome [BR:dre04147]
 Exosomal proteins
  Proteins found in most exosomes
   393586 (hsc70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 393586
NCBI-ProteinID: NP_956908
ZFIN: ZDB-GENE-040426-1221
Ensembl: ENSDARG00000012381
Vega: OTTDARG00000028164
UniProt: Q6PGX4
Position
15
AA seq 647 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPSNTVFDAKRLIGRRFDDPVVQSDMKHWPFKVISDGSKPKMEVEYKGEIKTFFPEEVS
SMVLTKMKEISEAYLGKTVSNAVITVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FITEFKRKFKKDITGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGADFYTSITRA
RFEELNADLFRGTLEPVEKALRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILTGDTSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEADQYRAEDEVQREKVTAKN
TLESLAFNMKSTVEDDKLQDKISPEDKKTITDKCNEVISWLDKNQTAEKDEYEHQQKELE
KVCNPIITKLYQGAGGMPGGMPGGMPGGYPGGQGSGSSSGPTIEEVD
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaggtccagcagtgggtattgatctgggcaccacctactcatgtgtgggaatc
ttccagcatggaaaggtggagatcatcgccaatgaccagggaaacagaacgacccccagc
tacgtcgctttcacggacaccgaaagactgatcggagatgcagccaagaaccaagttgcc
atgaacccttctaacactgtgtttgatgccaagcgcctgattggtcgacgctttgatgac
ccagtggttcaatctgacatgaagcactggccctttaaggtaatcagtgacggcagcaag
cccaaaatggaagtggagtacaaaggagagataaagactttcttccctgaagaggtgtcc
tccatggtcctcactaagatgaaggagatctccgaagcttaccttggcaagactgtatca
aatgcagtgattacggtgcctgcttactttaatgactcccagcgccaagccaccaaagat
gctggaaccatcgctggccttaatgtccttcgcatcatcaacgaaccaacagcagctgct
attgcatatggattggacaaaaaggtcggtggtgagcgcaatgtcctcatctttgatttg
ggtggtggcacctttgacgtgtccattctgaccatcgaggatggcatttttgaggtcaag
tcaactgcaggtgacacccatctgggtggtgaggacttcgacaaccgcatggtcaaccac
ttcatcaccgagttcaagcgcaagttcaagaaagacatcactggcaataaacgtgctgtc
cgtcgcctgcggacagcatgtgagcgtgccaagcgcaccctttcatccagcacacaggcc
agcattgagatcgactctctgtatgaaggtgctgacttctacacttccatcaccagagcc
cgttttgaggagctcaatgctgacctgtttcgcggtacactggagccagtggaaaaggct
ctgcgggatgccaagatggataaggcacagatccatgacattgtgctggttggtggctcc
actcgtattcccaagatccaaaagctgcttcaggacttctttaatgggcgagatcttaac
aagagcatcaaccctgatgaagccgtagcttatggagctgctgtccaggcagccatctta
acaggtgatacatcagagaatgtgcaagacttgttgctgctggacgtcactcctctctct
ctgggcattgagacagcaggtggtgtcatgaccgtgctaattaagaggaacaccaccatt
cccactaagcaaacccaaacctttaccacctactcagacaaccagccgggtgtactcatc
caggtatatgagggagagagagccatgacaaaggacaacaacattcttggcaaatttgag
ttgaccggcatccctcctgctcctcgtggtgtgccacagattgaagttacctttgacatt
gacgccaatggcatcctcaacgtatccgcagtagacaaaagcactggcaaagagaacaag
atcactattaccaatgacaaaggtcgtttgagcaaggaagacatagagcgtatggtacaa
gaggctgaccaatacagagcagaggatgaagtacagagggaaaaggtcaccgccaagaac
actctggagtccttggcctttaacatgaagagcactgttgaagatgacaagttgcaggac
aagatcagtccagaggacaagaaaactattactgacaaatgcaatgaggtcatctcatgg
ctggacaagaaccagaccgcagaaaaagatgagtacgagcatcaacagaaggagctggaa
aaagtgtgcaaccccatcatcactaagctctatcaaggcgctggtggcatgccaggtggg
atgccaggtgggatgcccggcggttaccctggagggcaaggaagtggttcttcctctggt
cctaccattgaggaagtggactaa

DBGET integrated database retrieval system