KEGG   Danio rerio (zebrafish): 393831
Entry
393831            CDS       T01004                                 

Gene name
dbi
Definition
(RefSeq) acyl-CoA-binding protein isoform 2
  KO
K08762  diazepam-binding inhibitor (GABA receptor modulator, acyl-CoA-binding protein)
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    393831 (dbi)
SSDB
Motif
Pfam: ACBP FGAR-AT_linker
Other DBs
NCBI-GeneID: 393831
NCBI-ProteinID: NP_001296092
ZFIN: ZDB-GENE-040426-1861
Ensembl: ENSDARG00000026369
Vega: OTTDARG00000028951
UniProt: E9QFI5
Position
9
AA seq 85 aa
MSEAEFQKAAEEVKQLKAKPTDAEMLEIYSLYKQATVGDVNTARPGMLDFTGKAKWDAWD
AKKGFQLDMAIFSNSMYCDNKHAPY
NT seq 258 nt   +upstreamnt  +downstreamnt
atgtctgaggccgagtttcagaaagccgcagaggaggtcaaacagctgaaagcaaaacca
acagacgctgagatgctggagatctacagtctgtacaagcaggccaccgtaggagacgtc
aacacagctcggccaggcatgctagacttcaccggtaaggccaaatgggatgcctgggat
gccaagaaaggtttccagctagacatggcgatattcagcaattcaatgtattgtgataat
aaacatgcaccatattga

DBGET integrated database retrieval system