KEGG   Danio rerio (zebrafish): 393922
Entry
393922            CDS       T01004                                 

Gene name
psmd13
Definition
(RefSeq) 26S proteasome non-ATPase regulatory subunit 13
  KO
K03039  26S proteasome regulatory subunit N9
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03050  Proteasome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    393922 (psmd13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dre03051]
    393922 (psmd13)
Proteasome [BR:dre03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     393922 (psmd13)
SSDB
Motif
Pfam: PCI Rpn9_C COX5A
Other DBs
NCBI-GeneID: 393922
NCBI-ProteinID: NP_957242
ZFIN: ZDB-GENE-040426-1004
Ensembl: ENSDARG00000016239
Vega: OTTDARG00000021176
UniProt: Q7ZU69
Position
25
AA seq 378 aa
MKDVLGFLKQQQSQSPTPEIAAEWHSLEDFYNRKLWHQLTLKLTVFVQDPYFAKGDGLIQ
LYENFLCDFEHRINPLSLVEIILHVARQMQDPNTAITFLEKTKEKVKASDEAVILCKTSI
GSLKLDISDLPATKKLIEEVEEMLNNLPGVTSVHGRFYDLSSKYYRIIGNHALYYKDALR
YLGCVEAKDLPEAEQQERAFTLGLAGLLGEGVYNFGELLMHPVLESLRNTDKQWLIDTLF
AFNAGNVEKFQALKTAWGQQPDLAAQEAKLMQKIQLLCVMEMTFTRPANNRQLSFQEIAQ
SAKIQVNEVELLVMKALSVGLIKGSIDEVEKKVHMTWVQPRVLDVQQIKGMKDRLDFWCG
DVKNMAVLVEQRAQDILT
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgaaagatgtgctcgggtttctcaagcagcagcagagccagagcccgacgccggagatc
gccgcagaatggcactcgctggaggatttctacaacagaaaattatggcatcagttgact
ctgaagttgacagtctttgtacaggacccctatttcgccaaaggggatggtctcattcag
ctctacgaaaacttcctctgtgatttcgaacacagaatcaacccattgtccttagtagaa
atcatccttcatgttgcaaggcaaatgcaagatccgaatacagccatcaccttcctggag
aaaacaaaggagaaggttaaagcgagtgatgaagctgttattctctgcaaaacgtccatt
ggcagcctcaaactcgacatcagcgatctcccggcaacaaagaaattaatagaagaagtg
gaagagatgctgaacaatctcccgggtgtgacgtcagtgcacggtcgattttacgacctg
tccagcaagtattaccgcatcattgggaaccacgctttatactacaaggacgccctgcga
tacctgggctgtgtggaagctaaagacttgccagaagcagagcagcaggagagagctttc
acgttaggtctggctggtctgctcggggaaggagtttataactttggcgaactgctgatg
cacccggtgctggagtcactcagaaacacagataaacagtggctcatcgacacactcttc
gcattcaatgccggcaatgtggagaaatttcaagccctcaagacggcgtggggccaacag
cccgatctcgcagctcaagaggccaaactcatgcagaagatccagttactgtgtgtcatg
gagatgactttcactcggccggccaataacagacagctgagtttccaggaaatcgcacag
agcgccaaaatccaagtcaacgaggtggagctactggtgatgaaggctctttctgtggga
ctgattaagggaagtatcgacgaggttgagaagaaggttcacatgacttgggttcagccc
cgagtgctggacgtacagcagattaagggcatgaaggaccgtctggacttctggtgtgga
gacgtgaagaacatggcagtgttggtggagcagcgggcgcaggacatcctcacctaa

DBGET integrated database retrieval system