KEGG   Danio rerio (zebrafish): 393973Help
Entry
393973            CDS       T01004                                 

Gene name
rae1
Definition
(RefSeq) mRNA export factor
  KO
K14298  mRNA export factor
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    393973 (rae1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dre03019]
    393973 (rae1)
   03036 Chromosome and associated proteins [BR:dre03036]
    393973 (rae1)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     393973 (rae1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    393973 (rae1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Nup160
Motif
Other DBs
NCBI-GeneID: 393973
NCBI-ProteinID: NP_957292
ZFIN: ZDB-GENE-040426-1029
Ensembl: ENSDARG00000007196
Vega: OTTDARG00000027251
UniProt: Q7ZWF0
Position
6
AA seq 368 aa AA seqDB search
MSLFGTNTGFGSGGTGVFGSTTTDSHNPMKDVEVTSPPDESISCLAFSPPTMPGNFLIGG
SWANDVRCWEVQDNGQTVPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHEGPIRTIHWIKAPNYSCIMTGSWDKTLKFWDTRSPNPMMSLQMPERCYCADVVY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQSKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTATPQDIYAVNAISFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPITACCFNHNGNIFAYASSYDWSKGHEYYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgtttgggacaaacacgggctttgggtctggagggaccggtgtatttggcagt
accaccacagacagccataatccaatgaaggatgttgaagtaacttcgccacccgatgag
agcataagctgcttggcatttagtcctcctacgatgcctgggaactttctcatcggaggt
tcgtgggccaatgacgtacggtgttgggaagtgcaagataatggtcagactgtccctaaa
gcccaacagatgcacactggcccagtactggatgtgtgctggagtgatgatggtagtaaa
gtctttacagcttcttgtgataaaactgccaagatgtgggatctgaacagcaatcaggcc
attcagatagctcaacatgaaggtccaatcaggacaattcactggattaaagcaccaaac
tacagctgtattatgactggcagttgggacaaaactttgaagttttgggatacacgttcc
ccaaacccaatgatgtccctccagatgccagagaggtgttattgtgccgatgtggtatat
cccatggctgttgtagccactgcagaacgtggtcttattgtttatcagttagaaaatcag
ccttcagagtttcgacgtatagagtcacctcttaagcatcagcaccgctgtgtggctatc
tttaaggacaaacagagtaagcctactggatttgccctgggcagcattgagggacgagtt
gccattcattacataaatccacctaacccagccaaggacaatttcacctttaagtgccac
aggtccaatggaaccaatactgccacaccccaagatatctatgctgtgaatgctatctcc
tttcaccctgtccatggcacactggcgacagtaggctctgatgggcgcttcagtttctgg
gataaagatgcccgtactaagctgaagacttctgaacaattagatcaaccaataacagct
tgttgcttcaatcacaatgggaatatatttgcctatgcatcaagttatgactggtccaag
ggacatgaatattacaatccccagaaaaagaattacatcttcttgcggaatgcagctgag
gaactgaaaccacggaacaagaaatga

DBGET integrated database retrieval system