KEGG   Danio rerio (zebrafish): 394048
Entry
394048            CDS       T01004                                 

Gene name
h2ax
Definition
(RefSeq) histone H2AX
  KO
K11251  histone H2A
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    394048 (h2ax)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    394048 (h2ax)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    394048 (h2ax)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    394048 (h2ax)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   394048 (h2ax)
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 394048
NCBI-ProteinID: NP_957367
ZFIN: ZDB-GENE-040426-987
Ensembl: ENSDARG00000029406
Vega: OTTDARG00000017886
UniProt: Q7ZUY3
Position
5
AA seq 142 aa
MSGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TGQAAASSGKSGKKGSSQSQEY
NT seq 429 nt   +upstreamnt  +downstreamnt
atgtctggaagaggtaaaaccggaggaaaagcccgcgccaaggctaagactcgcagctcc
cgcgccggtcttcagttccccgtcggccgtgttcaccgtctccttcgtaaaggcaactat
gctgagcgagtgggcgccggtgcccccgtgtatctggccgccgtgctcgagtacctgact
gctgagatcctcgagttggcgggaaacgccgcaagagacaacaagaagactcgtatcatc
ccccgccatctccagttggccgtccgtaacgacgaggagctgaacaaactgctcggcgga
gtgaccatcgcacagggcggtgttctgcccaacatccaggccgtgctcctgcccaagaag
accggtcaggctgcagccagctccggcaaatctggaaagaagggatcttcccagtcacaa
gagtattaa

DBGET integrated database retrieval system