KEGG   Danio rerio (zebrafish): 394075Help
Entry
394075            CDS       T01004                                 

Gene name
minpp1b
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 precursor
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00562  Inositol phosphate metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    394075 (minpp1b)
   00562 Inositol phosphate metabolism
    394075 (minpp1b)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     394075 (minpp1b)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     394075 (minpp1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 394075
NCBI-ProteinID: NP_957394
ZFIN: ZDB-GENE-040426-888
Ensembl: ENSDARG00000045172
Vega: OTTDARG00000021768
UniProt: Q7ZUU7
Position
12
AA seq 457 aa AA seqDB search
MKAFFLNFITTYLSIMVGLSLSKLAKPTVPSIAHYFGTKGRYEEVNPHLLDDVLFVNKSQ
VAPPSLDCRAIHMVSVIRHGTRYPTTKNVRKIAQLFDLVKSDSLRLASSWLNDLKTWKMW
YTEDMDGRLVEKGRDDHRHLAMRLAKSFPTLITADHLRANRIEFMTSSKHRCVDSVKAFQ
EGLHRLWDVQDMDYQHYVDDSLMRFFDHCEKFVEGVENNKTALKEVQRFKSSSEMDSVRR
KISSRLQIPYDRITADMAEAAFFLCSYEFAIKSEYSPWCELLDESDAQVLEYKNDLKQYW
KRGYGHDINRKSSCPLFHDIFSRLDNAAKDHRFGEVKKTATIQVGHGETLLPLLSLMGFF
KDEKPLTSENFALQRKRVFRSSKILPYAANVVLVLYECSDGLRVQLFLNEKPMIFPSMNH
AAPLYERVRKHYSKLLHGCDFNKECDLPQLNLRNTEL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttcttcttgaattttattactacgtatttgagcattatggttggtttatcg
ttaagtaaactcgccaaaccaacggtcccatcgatagctcattactttgggacaaaaggc
aggtacgaggaagtgaacccacatttattagatgacgttctgtttgtaaacaaatcgcag
gtggctcccccttccctagactgccgtgccatccatatggtgtctgtgatacgtcacggg
acacgctatccgaccaccaaaaatgtgagaaagatcgcgcaactgtttgatctggtcaag
tctgactcgctgcgtttagcttcatcctggctaaatgacttaaagacatggaagatgtgg
tacactgaagacatggacggcagactagtggagaaaggacgagatgaccataggcatttg
gccatgagactggcaaagtccttccccactttgattactgcagatcacctccgtgccaat
cgcatcgagttcatgactagctccaaacaccgctgtgttgatagtgtcaaagcctttcaa
gagggtcttcacagactctgggatgttcaagatatggattaccaacattacgtggatgat
tcactcatgagattctttgatcactgtgagaaatttgttgaaggtgttgaaaacaataaa
acagctctgaaggaagtgcagcgcttcaaatcttcatcagaaatggattcagtgcgcagg
aaaatatccagtcgtcttcaaattccatacgatcgaatcacggcagatatggctgaggca
gctttctttttgtgctcttatgagtttgccatcaagtcagaatactctccctggtgcgaa
ctgttagatgagtccgacgctcaagtgctggagtataaaaatgacctaaaacagtattgg
aagcggggatatggacatgacatcaaccgcaaatccagctgccctctctttcatgatatt
ttcagtcgtcttgataatgctgctaaagaccacagattcggagaggtgaaaaagactgcc
accattcaggttggtcatggtgaaaccctgctgcctctgctctctctaatgggcttcttc
aaggatgaaaaacctttaacttcagagaattttgcactacaacgcaaacgtgtattccgc
tccagtaagattttaccttatgctgcaaatgttgtcttggtcctgtatgaatgtagcgat
ggactaagagttcagttgtttcttaatgagaagcccatgatttttcccagcatgaaccat
gcagctcctctgtatgaaagagttcgaaagcattactcaaagcttcttcatggctgcgat
tttaataaggagtgtgatttgcctcagttgaatctcaggaacactgaactgtga

DBGET integrated database retrieval system