KEGG   Danio rerio (zebrafish): 394077
Entry
394077            CDS       T01004                                 
Symbol
pde10a
Name
(RefSeq) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
  KO
K18438  cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10 [EC:3.1.4.17 3.1.4.35]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00230  Purine metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    394077 (pde10a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     394077 (pde10a)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     394077 (pde10a)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 SpoVT_C PdtaS_GAF HD
Other DBs
NCBI-GeneID: 394077
NCBI-ProteinID: NP_957396
ZFIN: ZDB-GENE-040426-1115
Ensembl: ENSDARG00000003449
UniProt: A0A0R4IJT4 A0A8M1PC69
Position
13:4466140..4620874
AA seq 794 aa
MEDGPPSTSCFRRFTDCFLGSSLTDEKVKAYLSLHPQMLDEFVLESVSSETVDRWLKRKS
STQPADDSSAKEVSRYQDTNMQSVVYELNSYMEQRLDTGGDNKLLLYELCNIIKTATKAD
GFALYFLGECNNSLCLFTPTGAKEGLPGLIPSGPITFGTTIAAHVAKTRKTLLVEDIMGD
ERFPHGTGQDSGIRVHSVLCLPILTAIGDLIAILELHRHLGREPFNLSHQEVATANLAWA
SVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALF
QVDHNNKELYSDLFDIGEENEGKPVFRKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP
RFNREVDLYTGYTTRNILCMPIVSRGTVIGVVQMVNKLGGSAFTKTDENNFKMFAVFCAL
ALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWKTLTQLTLPSAIYKEIELFHFDIA
PFEELWPAIFVYMVHNSCGKTSFELEKLCRFTMSVRKNYRRVPYHNWKHAVTVAHCMYAI
LQKTTGIFTELERKGLLIACLCHDLDHRGYSNSYLQKFDHPLAALYSTSTMEQHHFSQTV
SILQEGHNIFSNLTSGEYEQVLEIIRKAIIATDLALYFGNRKQLAELLSTGALDLNNRAH
RDRVIGLMMTACDLCSVTKLWPVTRLTANDIYAEFWAEGDEMKKIGMQPISMMDRDKKDE
VPQGQVGFYNAVAIPCYTTLSELFPPSVPLLEACRENLSQWERIVQGEDVSAWSSTEEAE
VSETSDSGPVKVDN
NT seq 2385 nt   +upstreamnt  +downstreamnt
atggaagatggtccgccttccacaagctgtttccgaaggttcacggactgtttccttggc
tcaagtctgacggatgagaaagtgaaggcttatctctccctccacccgcagatgctggat
gagtttgtgctggagagcgtgagctcggagacggtggacagatggctgaagcggaagagc
agcactcagcctgcagatgactcctcagctaaagaagttagcaggtaccaggacacaaat
atgcagagcgtcgtttatgagctcaacagctacatggagcagcggctggacactggagga
gacaacaaactactgctctatgagttgtgcaacatcattaaaacagccactaaagctgac
ggatttgcactttacttccttggagaatgcaacaatagtttatgtttgttcactccgacg
ggggcaaaagaggggcttcctgggctcatcccctctggtcccattacgtttgggaccacc
atcgccgctcacgttgcaaagacacgcaagacactacttgtagaggacatcatgggggac
gagaggttccctcatggcacagggcaggactcagggatccgtgttcattctgttttgtgt
ttacccatcctcaccgccatcggagacctcatcgctatcctggagctgcaccgccacttg
ggtcgagagcccttcaacctcagccaccaggaggttgcaacagcaaatttggcctgggca
tctgtagccatacaccaagtccaggtctgcagaggtcttgccaaacagacggaactcaat
gactttctcctagatgtgtcaaaaacatactttgacaacatagtggcaatagattctcta
cttgaacatatcatgatatatgcaaaaaacctggttaatgcggacagatgtgcgctcttc
caggtggatcacaataacaaagagctgtattctgatctgtttgatatcggggaggagaat
gaagggaaacctgtcttcaggaaaaccaaagaaattaggttttcgattgagaaaggaata
gcaggtcaagtggcccgaacaggagaagttttgaatattccggatgcctatgcagacccc
cgtttcaacagagaagtagatctctacactggctacacgacgcggaatatcctgtgcatg
cccatagtcagccgcgggactgtgatcggtgttgtacaaatggtgaacaagctgggagga
agtgccttcactaaaactgacgagaacaactttaagatgttcgccgtcttctgtgctttg
gccttacactgtgcaaatatgtatcaccggataagacattcagagtgcatttaccgggtg
accatggagaagctttcgtaccacagcatctgtacgtcagaggagtggaagaccctcact
caactcaccctcccttcagccatatataaagagatcgaactgtttcactttgacattgca
ccgttcgaggagctgtggcctgcaatattcgtatacatggttcataattcatgtggaaaa
accagctttgagttggagaaactgtgccgcttcactatgtcagtgcggaaaaattacaga
agagttccataccacaactggaaacatgctgtgacggtggcacactgcatgtacgccatt
ttgcaaaagaccactgggatttttactgagcttgagaggaaagggttgctgattgcctgt
ttatgtcatgacctggaccaccgcggctacagtaacagttacctgcagaagtttgaccat
ccgctggcagccctgtattccacatccaccatggaacagcatcatttttcacagaccgtg
tccatcctgcaggaagggcacaatattttctccaacctgacttccggtgagtatgaacag
gtgctggagatcatcaggaaggccatcattgccacagacctcgctctgtacttcggcaac
cgcaagcagctggctgaactgctgtctacaggggcgctcgacctgaacaaccgcgctcac
agggaccgtgtgattggtctgatgatgaccgcctgtgatctctgctctgttaccaaatta
tggcccgtcacaagactcacagccaatgacatctacgccgagttctgggctgagggagat
gaaatgaagaagattggaatgcagcctatctccatgatggacagggataaaaaggatgag
gtaccccagggccaggtggggttttacaatgcagtggctattccctgttacaccactctg
tctgagctgtttcctccctccgttcctttgcttgaagcttgcagggaaaacctgtcccag
tgggagcgcattgtgcaaggggaggacgtctctgcgtggtcatcaaccgaggaggctgaa
gtgagcgaaacatcagacagtggaccagttaaagtggacaactga

DBGET integrated database retrieval system