KEGG   Danio rerio (zebrafish): 394114
Entry
394114            CDS       T01004                                 
Symbol
kdsr
Name
(RefSeq) 3-ketodihydrosphingosine reductase
  KO
K04708  3-dehydrosphinganine reductase [EC:1.1.1.102]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00600  Sphingolipid metabolism
dre01100  Metabolic pathways
Module
dre_M00094  Ceramide biosynthesis
dre_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    394114 (kdsr)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.102  3-dehydrosphinganine reductase
     394114 (kdsr)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR THF_DHG_CYH_C ADH_zinc_N NAD_binding_10 3Beta_HSD Bac_export_2 ApbA
Other DBs
NCBI-GeneID: 394114
NCBI-ProteinID: NP_957433
ZFIN: ZDB-GENE-040426-853
Ensembl: ENSDARG00000012021
UniProt: F1QWW8
Position
2:complement(13224291..13254800)
AA seq 359 aa
MSSEETLDSVLSHWLFFNTWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGA
HVVVTGGSSGIGKCIAMECYKHGAFITLVARDEHKLVQAKKEVEKFAINDKQVVLCISVD
VAKDYSQVESVIKQAQEKLGPVDMLVNCAGTSLSGKFEEVEVDHFKKMMEVNYLGSVYPT
RAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAEALQMEMKPYNIYVTV
AYPPDTDTPGFAEENKTKPLETKLISETSGVSQPEQVAKIVVKDAVQGNFTSSFGPDGYM
LSALTCGMSPVTSITEGLQQIVTMGLFRTIALFYLGSFDSIVRRCMIQREQCKAADKRE
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtcctctgaggaaactctcgactccgttctctcacactggcttttctttaacacctgg
tggcttctcctgccttttattatgctgcttgtagtggctgcttttattgtggcattcgtt
ctgctgttgtacatgatatcaccgttaataagccccaagcctctcaaactcaacggtgcc
catgtggtggtaactggaggcagcagcgggattgggaagtgtattgccatggaatgttac
aaacatggtgccttcatcaccttggtggcacgagatgagcacaaattggttcaggctaag
aaagaagtggagaagtttgccataaatgataagcaagtggttctttgcatttctgttgat
gtggcgaaagactacagccaagtggagagtgtcataaaacaagctcaagagaagctgggt
cctgtggacatgctggtgaattgtgccgggacatcattatctgggaagtttgaggaagtg
gaagttgaccatttcaagaaaatgatggaggtgaattatctgggcagtgtttaccccacc
cgtgcagtgatcaccactatgaaagaaaggcggatgggtcgcatcatgtttgtgtcatca
caggcagggcagatcggcctctttggctacacggcctactcaccctccaaatttgccttg
cgtggtctggctgaggccttgcagatggaaatgaaaccctataatatctatgttactgtg
gcatatcctccagacacagatacaccaggttttgcagaagagaataaaactaaacctctg
gaaaccaagttaatttcagagacatctggtgtctctcaaccggagcaagtggcaaaaatt
gtggtgaaagatgcggtgcagggaaatttcactagctcatttggtcctgatgggtacatg
ctgtcagcactgacctgtgggatgtcgcctgttacctccattactgaagggctgcagcag
attgtgaccatgggcctgttccgtaccattgctctcttctatctgggcagctttgacagc
atcgtccgccgttgtatgatccagcgagaacagtgcaaagcagctgacaagagggagtag

DBGET integrated database retrieval system