KEGG   Danio rerio (zebrafish): 394138Help
Entry
394138            CDS       T01004                                 

Gene name
asns
Definition
(RefSeq) asparagine synthetase [glutamine-hydrolyzing]
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00250  Alanine, aspartate and glutamate metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    394138 (asns)
Enzymes [BR:dre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     394138 (asns)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C44
   394138 (asns)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase tRNA_Me_trans QueC
Motif
Other DBs
NCBI-GeneID: 394138
NCBI-ProteinID: NP_957457
ZFIN: ZDB-GENE-040426-1091
Ensembl: ENSDARG00000016375
Vega: OTTDARG00000014748
UniProt: A3KQK2
Position
19
AA seq 560 aa AA seqDB search
MCGIWALFGSDECLSVQCTNAMKIFHRGPDAFRFENVNGFTNCCFGFHRLAIVDQLYGMQ
PLRVKKFPYLWLCYNGEIYNHIKLKNHFEFDYQTKVDGEILLHLYDRFGIEKMCSLLDGV
FAFILLDTANRKVHLGRDTYGVRPLFRMLTDDGFLAVCSEGKGLTQIKHSMPTAKITAFP
PGHFEVFDLKLNGKVESVQMDRFHCCTDKPKHADFNKLEGLGTDFELETVKSNIRILFED
AVRKRLMAHRRIGCLLSGGLDSSLVAALLVKLAKEEKLPYPIQTFSIGAEDSPDVAAARK
VADYIGSEHHVVNFTPEEGISALEDVIVHLESYDITTVRASIGMYLVSKYIREKTDSVVI
FSGEGSDELTQGYIYFHKAPSPKAGAEDSVRLLEELYLFDVLRADRTTAAHGLELRVPFL
DHRFTAYYLSLPEEMRVPKNGVEKHLLRDAFDGMNLIPDEILWRRKEAFSDGLTSVKKSW
YTSLQEHIESELNDSQLENANKLYHINPPTTKEGLFIRQIFEKHYPGQGEWTPHYWMPRW
IKATDPSARTLSIYKPDKEQ
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatatgggccttgtttggtagtgatgagtgcctttcagttcagtgcactaat
gccatgaagatctttcatcgtggaccggatgctttccgcttcgagaatgtcaacggtttc
actaactgctgctttgggtttcaccgtcttgcgattgtggaccagctttatggcatgcag
cctctgcgagtcaaaaagttcccttatctgtggttatgttacaacggtgaaatctacaac
cacatcaagctgaagaatcactttgagtttgactatcaaaccaaagtagatggtgagatc
cttctgcatctgtacgatcgctttggaatcgagaagatgtgctccctgctggatggtgtg
ttcgccttcatcttattagacacagctaacagaaaggttcacttgggaagagatacatac
ggcgtgagaccgctattcagaatgctgactgacgatggttttctagctgtctgttctgaa
ggcaaaggtctaacacagatcaaacactccatgcccactgcaaagatcactgcttttcca
ccgggacactttgaggtgtttgacttgaagctcaatgggaaagtggagtctgttcagatg
gatcgctttcactgctgcacagacaaacccaaacatgctgactttaacaaactcgaggga
ctgggcacagacttcgaattggagacagtcaagagcaacattaggatcctgtttgaggat
gcagtaaggaaacgcttgatggctcacagaagaatcggttgccttctctcaggtggtctc
gactcaagtctggttgctgctttgcttgtgaaactggccaaagaagagaagcttccatat
cccattcagactttttccattggtgctgaggacagtccagatgtcgctgctgctcgcaag
gtggcagactacattggcagcgagcaccatgtggtaaactttacaccagaggaaggcatc
agtgcgctggaggacgtcatcgttcacttagagagttatgacatcaccactgttcgtgcc
tctattggaatgtacctggtatcaaaatacatccgagagaagacagacagtgtggtgatt
ttctcaggtgaaggttcagatgagctgacacaaggatacatctactttcataaggctcca
tcacctaaagctggtgcagaggacagtgtgcgtctgctggaagagctttatctgttcgat
gtgctgagagccgacagaaccactgctgctcatggactggagttgagagtgcctttcctg
gaccacaggttcacagcgtactacctctctctgcctgaagagatgagagtgcctaagaat
ggtgtggagaagcatcttttgagggatgcatttgatgggatgaacctgattcctgatgag
atcctttggagaaggaaagaggctttcagtgacggtttgacatcagtgaagaaatcgtgg
tacaccagcctacaggagcacatcgagtctgagctgaatgactctcagttggagaatgct
aataaactgtaccatatcaatcctcccacaaccaaagagggcttgttcatcagacagatc
tttgagaagcattaccctggccaaggtgagtggacgccacattactggatgccccgctgg
atcaaggccacagacccttcagccagaacactgtccatctacaagcctgataaagagcag
taa

DBGET integrated database retrieval system