KEGG   Danio rerio (zebrafish): 394157
Entry
394157            CDS       T01004                                 

Gene name
bcs1l
Definition
(RefSeq) mitochondrial chaperone BCS1
  KO
K08900  mitochondrial chaperone BCS1
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dre03029]
    394157 (bcs1l)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-III assembly factors
    394157 (bcs1l)
SSDB
Motif
Pfam: BCS1_N AAA AAA_16 Rad17 RNA_helicase AAA_33 AAA_5 DUF815 AAA_25 AAA_18 ABC_tran AAA_29 RuvB_N AAA_28 ATPase AAA_7 AAA_24 AAA_17
Other DBs
NCBI-GeneID: 394157
NCBI-ProteinID: NP_957476
ZFIN: ZDB-GENE-040426-938
Ensembl: ENSDARG00000012295
Vega: OTTDARG00000020920
UniProt: Q7ZV60
Position
9
AA seq 420 aa
MTLSDFIGALKDNPYFGAGFGLVGVGTALAVARKGAQVGMIFFRRHYMITLEVPSKDKSY
HWLLSWITKHAKHTQHLSVETSYMQHESGKVHTQFDFHPSPGNHIIWYGRKWIRVERVRE
KQMMDLHTGTPWESVTFTALGRDRQTFFNILQEARELALKQEEGRTVMYTAMGAEWRPFG
FPRRRRPLSSVVLESGVAERIVDDVKEFIGNPKWYTDRGIPYRRGYLLYGPPGCGKSSFI
TALAGELGYSICLMSLSDRSLSDDRLNHLLSVAPQQSIILLEDVDAAFVSRELLPTENPL
AYQGMGRLTFSGLLNALDGVASSEARIVFMTTNFIERLDPALVRPGRVDLKQYVGHCSHW
QLTQMFRRFYPQESAAEADHFSEQALAAHTDLSAAQVQGHFMLYKTDPAGAIKNIAEIKD
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgaccctgtcagattttattggagccctgaaggacaatccttattttggggcaggattt
ggactagttggtgttggcacggcacttgcagttgccagaaaaggagcacaggttggcatg
attttctttcggaggcattacatgatcactctggaggttccaagcaaagataaaagttac
cactggctcttaagctggatcaccaaacatgccaaacacacacagcatctgagtgtagag
acctcatacatgcagcacgagagtgggaaagtccacacacagtttgacttccacccaagc
ccaggcaaccacatcatatggtatggaaggaagtggatcagagtggagcgggtcagggag
aagcagatgatggacctgcacactggaacgccctgggagtctgtcacctttactgctttg
ggaagagaccgccagacattcttcaacatacttcaggaagcacgtgaacttgctttaaag
caggaagagggccggacagtgatgtacactgcaatgggagcggagtggagaccctttggt
tttccaaggagaagacggccgctgtcttcagtagtgctggagagtggagtggcggagagg
attgtggatgatgtaaaggagttcataggcaatcctaagtggtacactgacagaggcatt
ccatacaggaggggatatttgctgtatggcccacctggctgtggaaagagcagctttata
actgctctggcaggtgagctgggctacagcatctgtctgatgagtctgagcgaccgcagc
ctgtctgatgatcgcctcaatcacctgctgagcgtcgctccgcagcagagcatcatcctg
ctcgaggacgtagatgcagcctttgtcagccgcgagctgctgcccaccgagaatccactg
gcctatcaaggtatgggacggcttacgtttagtgggcttctgaatgctctggatggagtg
gcatcttcagaggcccgaattgtcttcatgactactaatttcattgagagactcgatccg
gctctcgtccgccccggccgtgtggatctgaagcagtatgttggccactgctcgcactgg
cagctgactcagatgtttcggaggttttaccctcaggagtctgcagccgaggcagatcac
ttctctgaacaagcactggccgctcacacagatcttagcgccgctcaggtacaaggacac
ttcatgctctacaagactgacccagccggggctatcaaaaacattgcagagattaaggac
tga

DBGET integrated database retrieval system