KEGG   Danio rerio (zebrafish): 399481Help
Entry
399481            CDS       T01004                                 

Gene name
aldh9a1b
Definition
(RefSeq) 4-trimethylaminobutyraldehyde dehydrogenase B
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00053  Ascorbate and aldarate metabolism
dre00071  Fatty acid degradation
dre00280  Valine, leucine and isoleucine degradation
dre00310  Lysine degradation
dre00330  Arginine and proline metabolism
dre00340  Histidine metabolism
dre00380  Tryptophan metabolism
dre00410  beta-Alanine metabolism
dre00561  Glycerolipid metabolism
dre00620  Pyruvate metabolism
dre01100  Metabolic pathways
Module
dre_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    399481 (aldh9a1b)
   00053 Ascorbate and aldarate metabolism
    399481 (aldh9a1b)
   00620 Pyruvate metabolism
    399481 (aldh9a1b)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    399481 (aldh9a1b)
   00561 Glycerolipid metabolism
    399481 (aldh9a1b)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    399481 (aldh9a1b)
   00310 Lysine degradation
    399481 (aldh9a1b)
   00330 Arginine and proline metabolism
    399481 (aldh9a1b)
   00340 Histidine metabolism
    399481 (aldh9a1b)
   00380 Tryptophan metabolism
    399481 (aldh9a1b)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    399481 (aldh9a1b)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     399481 (aldh9a1b)
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     399481 (aldh9a1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 399481
NCBI-ProteinID: NP_958916
ZFIN: ZDB-GENE-040120-5
Ensembl: ENSDARG00000037061
Vega: OTTDARG00000019364
UniProt: Q802W2 B2GT49
Position
2
AA seq 518 aa AA seqDB search
MALMRCLLPPGFYRTLYNPGTRCASSGTLQIKDPLNFWCGARVDLKDVKTKSEPVFEPAT
GRVLCRLQTCGSAEVDAAVRNASVAFTVWRKLSGMERARVMMEAARLIEKRREEIAEMEV
INNGKSITEARLDVDSARLCIEYFAGQATTLSGQHVQLPGGSFAYTHREPFGVCVGIGAW
NYPFQIAAWKSAPAIACGNSMVFKPSPLTPVTAVLLAEIYRQAGAPDGLFNVVQGGQETG
SLLCLHPSVEKVSFTGSVPTGKKIMEMASRGVKAVTLELGGKSPLIIFEDTDLENAVRGA
LMANFLSQGQVCSNGTRVFVQSSIVPQFLKEVVRRTKAISIRDPLLDETRMGALVSKAHL
DKVLRYVEQAKNEGAQVLCGGEPFSPADPKLKDGYYMTPCVLDSCTDDMTCVKEEIFGPV
MSVLTFDTEDEVLRRANDSDLGLAAGVFTKDVKRAHRVIENLQAGSCFINNYNITPVEVP
FGGFKASGIGRENGQVTIEFYSQLKTVVVEMGDVDSLF
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggcccttatgaggtgtctcctgcccccgggtttctacaggaccctatataaccccggg
accaggtgtgcgtcctcaggaacccttcaaattaaagatccactgaacttctggtgtggt
gcccgggtcgaccttaaagatgtgaagaccaaatctgaaccagtatttgagcctgcaaca
ggtcgtgtcctctgccggctgcagacgtgtgggtcagcagaggttgatgcagcggttaga
aacgccagtgttgcttttacagtctggaggaaactgtcaggcatggaaagagccagagtg
atgatggaggctgcccgactcattgagaagagaagagaggagatcgcagagatggaggtg
atcaacaatggaaagtccatcacagaagcccgtttggatgtggactcagccagactgtgc
attgagtatttcgcaggacaagccaccacactgtccggtcagcatgtccagctaccaggg
ggttcatttgcgtacacgcaccgtgagccgttcggtgtgtgtgtgggaataggagcctgg
aattaccccttccagatcgcagcctggaaatctgcccctgccatcgcttgtgggaactct
atggtgttcaagccgtctccgctgacccctgtgaccgcagtgctgctggcggagatttac
aggcaggccggggctcctgacggcctgttcaatgtggttcagggcggacaggagaccggc
tctctgctctgtcttcacccttcggtggaaaaagtctccttcactggaagtgtgcccaca
gggaagaagatcatggaaatggcgtctcggggggtgaaagcagtgacgctggagctcggg
gggaaatctccactcatcatcttcgaggacacagacctggaaaacgctgttagaggagct
ctcatggccaacttcctctcgcaaggacaggtgtgcagtaacggcaccagagtgtttgtg
caaagctcgattgttcctcaattcctgaaagaggtggtcaggagaactaaagctatcagc
attagagaccctctgctagacgagacccgcatgggcgccctggtcagcaaagcacatctg
gataaagtgctgcgatacgtggagcaagccaagaacgagggagcccaagtgctttgtgga
ggagagcctttcagccctgcagatccgaaactaaaagatggatactacatgactccatgt
gtgctcgacagctgcactgatgacatgacgtgtgtgaaggaggaaatattcgggcctgtg
atgtcagtattgacctttgacactgaagacgaggttcttcgaagagcaaatgacagcgat
cttggcctcgctgcaggagtctttaccaaagatgttaagagagcgcatcgtgttatagaa
aacctgcaggctggatcttgcttcatcaataactacaatatcactcctgtagaggtgccg
tttggaggattcaaggcttcaggtattggaagggaaaatggccaggtgaccattgagttt
tactctcagctgaagactgtggtggtggagatgggagatgtcgacagtcttttctaa

DBGET integrated database retrieval system