KEGG   Danio rerio (zebrafish): 399482
Entry
399482            CDS       T01004                                 

Gene name
arpc5b
Definition
(RefSeq) actin-related protein 2/3 complex subunit 5b
  KO
K05754  actin related protein 2/3 complex, subunit 5
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04144  Endocytosis
dre04530  Tight junction
dre04810  Regulation of actin cytoskeleton
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    399482 (arpc5b)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    399482 (arpc5b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    399482 (arpc5b)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    399482 (arpc5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    399482 (arpc5b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dre04812]
    399482 (arpc5b)
Membrane trafficking [BR:dre04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    399482 (arpc5b)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     399482 (arpc5b)
SSDB
Motif
Pfam: P16-Arc Utp12
Other DBs
NCBI-GeneID: 399482
NCBI-ProteinID: NP_958917
ZFIN: ZDB-GENE-040120-7
Ensembl: ENSDARG00000019062
Vega: OTTDARG00000006186
UniProt: Q7ZWH4
Position
20
AA seq 150 aa
MSKNTVSDRFRKVDVDEYDENKFVDEEEGGENQLGPDEAEVDSLIRQGNLMGALQAVLKN
PPINTKNQNVKDRAEGLVLKVLSSFKSTDIEKGVQSLDKNGVDLLMKYIYKGFERPSENS
SAVLLQWHEKALSAGGVGCIVRVLTARKTV
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtcaaagaacacggtgtccgatcgtttcaggaaagtggacgtggatgagtacgacgag
aacaagtttgtggacgaagaagaaggaggagaaaaccagctgggtccagatgaggcagag
gtggattctctcatcagacaaggaaacctcatgggtgctctacaggcagtattaaaaaac
ccaccaatcaatacaaagaatcaaaacgtcaaggatcgagctgaaggtctggtgctgaag
gtgctcagctcctttaagagtactgacatagagaaaggagttcagtctctggataaaaat
ggagtggacctgctcatgaaatacatctacaaggggtttgagcggccgtctgaaaacagc
agcgccgttctactgcagtggcatgaaaaggctctttctgcgggtggagtgggctgcatc
gtgagggtccttacagccagaaaaactgtgtaa

DBGET integrated database retrieval system