KEGG   Danio rerio (zebrafish): 402795
Entry
402795            CDS       T01004                                 

Gene name
sts
Definition
(RefSeq) steryl-sulfatase isoform X1
  KO
K01131  steryl-sulfatase [EC:3.1.6.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    402795 (sts)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.2  steryl-sulfatase
     402795 (sts)
SSDB
Motif
Pfam: Sulfatase Sulfatase_C Phosphodiest
Other DBs
NCBI-GeneID: 402795
NCBI-ProteinID: XP_005168454
ZFIN: ZDB-GENE-030717-5
Ensembl: ENSDARG00000053241
Vega: OTTDARG00000029840
UniProt: F1QB82
Position
1
AA seq 584 aa
MKSFQWIPCTFCLLLYTADAGSGTKPNFVFMMVDDLGIGDLGCYGNTTLRTPNIDRLALE
GVKLTQHIAAAPLCTPSRAAFLTGRYPIRSGMAAHGHMGVFLFSASSGGLPQEEITFAKA
VKVQGYSTAVIGKWHLGLNCEDSSDHCHHPNSHGFDYFYGTIMTHLRDCQPGHGSVLYNV
YSHIPFKPLSIGLVSLVVLHIRGMLTVSRRVFFSFLILVGLVLSLFRLLVYTFPNLNCFV
MRGTEIVEQPYISENLTQRMTSEAIEFLERNSETPFLLFFSFIQVHTGVFASPLFRGRSQ
HGLYGDAVMEVDWSVGQIMQTLERLNLKDNTLVYMTSDQGPHLEEISVHGEMHGGYSGIY
KAGKSTNWEGGIRIPGILSWPGVLPAGNIIDEPTSNMDIFPTVLNLAGASIPDDRVIDGH
DLLPLLQGQVKRSEHELLFHYCNAELNAVRWRPPNSSAIWKAFFFTPDFYPKNSSACFHT
HVCFCIKPFVTFHDPPLLYDLSKDPTESTPLSPDTEPQFHSVLEVIRAAVSRHTQSLKPV
PVQVSPLKIVWKPWLQPCCSSLSQLCRCERDHQIEKVQDGLQKE
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgaaatcctttcaatggattccctgcactttctgtctgctgctctatactgctgatgcc
ggcagtggtacaaaacctaattttgtctttatgatggtggacgatttaggaattggagac
cttggatgctatggaaacacaactctcaggacgcccaacattgacagactggctctggaa
ggggtgaaactgacccaacacattgctgctgcgccactctgcactcccagcagggcagcc
tttctcacaggcagatatcccatccgatcaggtatggcagcacatggccatatgggagtg
tttctcttttctgcatcgtcaggaggtcttccacaagaggaaatcacctttgccaaggct
gtcaaggtgcaaggttattccaccgctgtaattgggaaatggcaccttggtcttaactgt
gaagacagttctgaccactgccaccatccaaactcacatggcttcgactacttctatggt
accattatgacgcaccttcgggactgccagcctggacatggctctgtcttgtataacgtt
tatagtcacatcccattcaagccccttagtatcggtttagtttccctagtagtactccat
attagagggatgctaactgtgagcaggagggtatttttcagttttctgatcctggtaggg
ctggtgctgagtctctttcgtttgttagtatacacattccccaatctaaattgctttgtc
atgagaggaacggaaattgtggaacaaccatatatctcagaaaacctcacacaaaggatg
accagtgaagccatagagtttctggaaaggaattcagagaccccattcttgctcttcttc
tcatttattcaagtccacacaggagtttttgcctctcctctcttcaggggaaggagccaa
catggcctctatggtgatgctgtcatggaagtagactggagtgtaggtcagatcatgcag
actctggagcgcttaaacttgaaggacaacactctagtgtacatgacctcagatcagggg
cctcacctggaagagatttcagtccacggagagatgcatgggggctatagcggcatatac
aaagctggcaagtcaactaactgggaaggaggaatccgaattccgggcattcttagttgg
ccaggtgtcttacccgccgggaatatcatcgatgagcccactagtaacatggatattttc
cctacggtcttgaatttagctggtgcttccatacccgatgacagagtcatcgatggtcat
gatcttttgccacttctgcaagggcaagtgaagcgttctgaacatgaactcttgtttcat
tactgcaatgctgaactgaatgctgtcagatggcgcccacccaacagtagtgcaatttgg
aaggcctttttctttacccctgacttctacccaaagaacagctcggcatgtttccacact
catgtctgcttctgcatcaagccattcgtcacgtttcatgatcctccgctgctttatgac
ctatccaaagacccaacagaaagcacccccctgagtcccgacaccgagcctcagttccac
tcagttctagaggtcataagagccgcagtaagccgtcatacacagagcctgaaacctgtc
ccagtgcaggtctctcctctgaaaatagtgtggaagccttggctccagccctgctgttct
tctctcagtcagctgtgcaggtgtgaacgagatcatcagatagagaaggtacaggacggg
cttcaaaaagaatag

DBGET integrated database retrieval system