KEGG   Danio rerio (zebrafish): 402802
Entry
402802            CDS       T01004                                 

Gene name
pla2g12a
Definition
(RefSeq) group XIIA secretory phospholipase A2 precursor
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00564  Glycerophospholipid metabolism
dre00565  Ether lipid metabolism
dre00590  Arachidonic acid metabolism
dre00591  Linoleic acid metabolism
dre00592  alpha-Linolenic acid metabolism
dre01100  Metabolic pathways
dre04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    402802 (pla2g12a)
   00565 Ether lipid metabolism
    402802 (pla2g12a)
   00590 Arachidonic acid metabolism
    402802 (pla2g12a)
   00591 Linoleic acid metabolism
    402802 (pla2g12a)
   00592 alpha-Linolenic acid metabolism
    402802 (pla2g12a)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    402802 (pla2g12a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    402802 (pla2g12a)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     402802 (pla2g12a)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    402802 (pla2g12a)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 402802
NCBI-ProteinID: NP_001076268
ZFIN: ZDB-GENE-070410-18
Ensembl: ENSDARG00000070454
Vega: OTTDARG00000027100
UniProt: A3KNJ5
Position
1
AA seq 198 aa
MHCRVILSCVTLLLSGVLLSTKADGSDEEIKPPDWRKTINSIRSGIHRIDKYLNMALDLI
GGSDGQCQFTCGDGSSDIRYTPVPRPNYRPPPPNGCGSPLFGFQFDVGIPSMTRCCNEHD
RCYDSCGREKSDCDEQFQLCLENICQNLQMTLGLSQSVQACESAVTVLFDTVMHLGCKPY
LDSQRSACICHYEEKPDL
NT seq 597 nt   +upstreamnt  +downstreamnt
atgcactgtcgtgtcatcctctcctgcgttaccctgctgctctctggagtattattatcg
accaaagctgatgggtctgatgaagaaattaaacccccagactggagaaagaccataaac
tccatccggagcgggattcaccggatcgacaagtacctcaacatggctctggacctgatc
ggaggctcagacggccagtgtcagttcacgtgcggcgacggttcgtcagacatcaggtac
acaccggttcctcgtcctaactacagaccacctccaccaaacggatgtggttcaccgctg
tttgggtttcagtttgatgttgggatcccgtctatgaccagatgctgtaatgagcacgac
cgctgctacgactcctgcggcagagagaaaagcgactgtgatgagcagttccagctctgt
ctggagaacatctgtcagaacttacaaatgacactgggcttgtcccaaagcgttcaagcc
tgtgaatcagcagtgactgtgctcttcgataccgtcatgcacttgggatgtaagccgtac
ctggacagccaaagatcagcctgcatttgccactacgaggagaagcctgatctgtaa

DBGET integrated database retrieval system