KEGG   Danio rerio (zebrafish): 402852
Entry
402852            CDS       T01004                                 

Gene name
pane1
Definition
(RefSeq) centromere protein M
  KO
K11505  centromere protein M
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    402852 (pane1)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     402852 (pane1)
SSDB
Motif
Pfam: CENP-M
Other DBs
NCBI-GeneID: 402852
NCBI-ProteinID: NP_991153
ZFIN: ZDB-GENE-040611-4
Ensembl: ENSDARG00000024681
Vega: OTTDARG00000029938
UniProt: Q7ZZC6 B8JLC6
Position
1
AA seq 186 aa
MALLSPYSKVPELNTATVLLVENEEELQNKLANAIVQHEKDFNVNVRLAKKLPLPVENKE
ARPRIDLIVFIVSLLSERSLQSAESSLSHLHSDCFLGKVCFLVTDARCGSHTQERLVSVR
KLAASHHCPVICAEHRTAEGVSAAALRLLNILQVSAGMTPISTTALYLSTLTRCSLTSDL
QEDYLQ
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcgctcctgtcgccgtacagtaaagtccccgagctgaacaccgctactgttctcttg
gttgaaaatgaggaggagctgcagaacaaactagccaacgccatagtacaacatgagaag
gatttcaacgtcaatgtacgtttggccaagaaactccctctgcctgttgagaacaaggaa
gctcgtccacgtattgatttgatagtgtttatagtgagtctgctgtccgagcgcagtctt
cagtctgcagagagttccctcagtcatcttcattcagactgttttctggggaaagtgtgt
ttcctggtgactgacgctcgctgtggttctcacactcaggagcgtttggtcagtgtgagg
aaactggctgcttcacatcactgtcccgtcatctgcgctgaacacaggactgcagagggt
gtgagcgctgcagctctgcgtcttctcaatattctgcaggtttcagcaggaatgacccct
atctccaccacggccctctacctgtccacactgacccgctgctcgctgacctctgacctc
caggaggactacctgcagtaa

DBGET integrated database retrieval system