KEGG   Danio rerio (zebrafish): 402979
Entry
402979            CDS       T01004                                 

Gene name
cdab
Definition
(RefSeq) cytidine deaminase b
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00240  Pyrimidine metabolism
dre00983  Drug metabolism - other enzymes
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    402979 (cdab)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    402979 (cdab)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     402979 (cdab)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 dCMP_cyt_deam_2
Other DBs
NCBI-GeneID: 402979
NCBI-ProteinID: NP_991242
ZFIN: ZDB-GENE-040426-1911
Ensembl: ENSDARG00000038199
Vega: OTTDARG00000022430
UniProt: Q6P0R4
Position
11
AA seq 159 aa
MEDQKMMHELINGLNGHLLGIKELTRKSQEAKKFAYCPYSKFRVGAALLTHDGTVFTGCN
VENACFNLGICAERVAISKAVSEGYRDFKAIAIASDMCENFISPCGGCRQFMREFGSNWE
VYLSKPDGSYVEMTVEELLPASFGPEDLKMKKANIRNEF
NT seq 480 nt   +upstreamnt  +downstreamnt
atggaagaccaaaagatgatgcatgagcttattaatgggttgaatgggcacttgttggga
ataaaagagttgactcgaaaatctcaagaggctaagaagtttgcctattgcccatacagc
aagtttcgagtcggggcagcactgctgacacatgacgggacggttttcacagggtgtaac
gtggaaaacgcatgcttcaacctgggaatctgtgctgagagagttgccatttccaaagct
gtatctgagggctacagggatttcaaagccattgctattgcgagtgatatgtgtgagaac
tttatttccccctgtggaggatgccggcagttcatgagagagtttggttctaactgggaa
gtgtatttgtccaaacctgacggttcctatgttgagatgacggttgaggaacttctgcct
gcatctttcggaccagaggacttaaaaatgaagaaagcgaacattcggaatgagttctga

DBGET integrated database retrieval system