KEGG   Danio rerio (zebrafish): 402984
Entry
402984            CDS       T01004                                 

Gene name
hnrnph1
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein H
  KO
K12898  heterogeneous nuclear ribonucleoprotein F/H
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dre03041]
    402984 (hnrnph1)
Spliceosome [BR:dre03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    402984 (hnrnph1)
SSDB
Motif
Pfam: RRM_1 zf-RNPHF
Other DBs
NCBI-GeneID: 402984
NCBI-ProteinID: NP_991247
ZFIN: ZDB-GENE-040426-1856
Ensembl: ENSDARG00000040881
Vega: OTTDARG00000041967
UniProt: Q6P0V0
Position
14
AA seq 403 aa
MADGEGFVVRVRGLPWSCSVDEVQRFFSECKIASNGTSIHFTYTREGRPSGEAFVEFESE
EDLKIAVKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNCPETGGDGLVRLRGLPFGCSK
EEIVQFFAGLEIVPNGITLPVDFQGRSTGEAFVQFASQDIAEKALKKHKERIGHRYIEIF
KSSRAEVRTHYEPQRKVMGMQRPSPYDRPGGGRGYNSMGRGVSFERMRRGGYGGDGRYGD
SGSSFQSTTGHCVHMRGLPYRATETDIYNFFSPLNPVRVHLEIGPDGRVTGEADVEFATH
EDAVAAMSKDKANMQHRYVELFLNSTAGGGSGGYGGQMMGGMGNQSSYGHSSQQMGSGYG
GGYANQSGMGGYSDYSECQLFRSSASRFHAKSYRPWTPKGSCL
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggcggatggagaaggttttgtggtgagagtcagaggtttaccttggtcctgctctgtt
gatgaagttcagaggtttttctcagagtgcaaaattgcaagcaatgggacaagcatacac
ttcacatacacacgggaaggtcgtccaagtggagaggcatttgtcgagtttgaatcggag
gaagatctcaaaattgcagtgaagaaagatcgtgaaaccatggggcaccgttacgtagaa
gtattcaaatccaatagtgttgagatggactgggttctgaagcacaccggtccaaactgt
ccagagacaggaggtgacggcctggttaggcttcgaggtttgccctttggatgcagcaag
gaggaaattgtccagttttttgcagggttggaaatcgtgccaaatgggataacattgccg
gtggacttccaggggaggagtacgggggaggccttcgtgcagtttgcttcacaggatata
gccgaaaaggctctaaagaaacacaaggaaagaatagggcacaggtatatagagatcttc
aagagcagccgtgcggaagtacgcacacattacgaaccccagcgaaaggtcatgggcatg
cagagaccgagcccctatgataggccagggggcggcagaggatacaacagcatgggcaga
ggagtctcctttgagagaatgagacgtggcggctacggtggagatggtcgttatggagac
agcggctcttcctttcagagcacaacgggacactgtgtgcacatgagaggccttccttac
agagccactgagaccgacatatacaatttcttttctccgctgaacccggtgcgtgtgcat
ttagagattggtcctgatgggagagtgacaggagaggccgatgtagaatttgccacacat
gaggacgcggtggctgccatgtccaaagacaaagccaatatgcagcaccgttatgtggag
ctgttcctgaactccacagctggaggcggaagtggaggatatggtggtcaaatgatgggc
ggtatgggaaaccagtcgtcatacggacacagcagtcagcagatgggctcaggctatggt
ggcggttacgctaaccagagtggcatggggggctacagtgactacagtgagtgtcagctc
ttccgtagctccgctagccgcttccatgccaaatcctatcggccttggacccctaagggt
agctgtttgtaa

DBGET integrated database retrieval system