KEGG   Danio rerio (zebrafish): 402985Help
Entry
402985            CDS       T01004                                 

Gene name
grhprb
Definition
(RefSeq) glyoxylate reductase/hydroxypyruvate reductase b
  KO
K00049  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00260  Glycine, serine and threonine metabolism
dre00620  Pyruvate metabolism
dre00630  Glyoxylate and dicarboxylate metabolism
dre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    402985 (grhprb)
   00630 Glyoxylate and dicarboxylate metabolism
    402985 (grhprb)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    402985 (grhprb)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     402985 (grhprb)
    1.1.1.81  hydroxypyruvate reductase
     402985 (grhprb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored Kei1
Motif
Other DBs
NCBI-GeneID: 402985
NCBI-ProteinID: NP_991248
ZFIN: ZDB-GENE-040426-1847
Ensembl: ENSDARG00000019986
Vega: OTTDARG00000021662
UniProt: F1QYH7 Q6P0V7
Position
1
AA seq 361 aa AA seqDB search
MWCSRTALGRLQRIAPCTVTGHHRAMSALPKVYVTRRIPPDGLDILRKSGQVQFELWDSD
DPVPRVELLNKVKGCDGILCVLTEKIDAQLLDVAGPNLKVLSTMSVGYDHLSLEELKKSL
LIWACIFCRGIRVGYTPEVLTDAVAELTVALLLATSRRLIEATHEAKTGGWGTWRTMWLC
GHELANSTVGILGLGRIGVAIAERLKPFKVKKFIYTDVEPRTELANMINAEYVSLDELAK
QSDFLAICCALTPETHGICNWNLFSKMKKNAIFINTSRGGVVNQEDLYEALSTGLIAGAG
LDVTTPEPLPTHHPLYTLKNCVILPHIASASYTTRNAMSALAANNLLAGLRGEAMPKELK
L
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgcagcagaacagcgctcgggagactacagagaatcgccccctgtaccgtgacc
ggacatcaccgcgcgatgtccgcgttaccgaaagtgtatgtgacccgcaggattccacca
gatggactggacattctgcgaaaatccggacaagtccagtttgagttgtgggactctgat
gaccccgtgccccgagtggagctgctgaacaaggtcaaaggttgtgatgggattctgtgt
gtacttacagagaagattgatgcacagctgctggacgtggcaggtccaaatctgaaagtc
ctcagcaccatgtcagtgggctatgatcacctttctctcgaagagcttaagaaaagtttg
ttgatatgggcttgtatattttgtagaggaatccgtgtaggatatacacctgaagtcctg
accgatgctgtggctgaactgactgttgctctgttactcgccacatccagaagacttatt
gaagctacgcatgaagctaaaactggtggctggggaacttggagaactatgtggttgtgc
ggtcatgaactagcaaacagtacggttggaatcttgggacttgggaggattggtgttgct
attgctgagcgtctgaagccatttaaggtgaagaagttcatctatacagatgtggagcca
agaactgagcttgcaaacatgataaatgcagaatacgtgtctttagatgaactggccaag
cagtcagactttctggccatatgttgcgctttgactccagagactcatggcatctgcaat
tggaatctcttctccaagatgaagaaaaatgccatcttcatcaacacgagcagaggtggc
gtggtgaaccaggaggatctgtatgaagctctgtcgacgggtctgattgctggcgcaggg
ctggacgtcaccactcctgaaccgctgccaacacaccatccgctctacaccctcaaaaac
tgcgtgattcttcctcacattgccagtgcgtcctataccacacgaaacgccatgtcagcc
ctcgctgccaacaacctgctggcaggactcagaggtgaagccatgcccaaagagctgaaa
ctgtag

DBGET integrated database retrieval system