KEGG   Danio rerio (zebrafish): 403015
Entry
403015            CDS       T01004                                 

Gene name
si:rp71-45k5.4
Definition
(RefSeq) proteasome_alpha_type_2 domain-containing protein
  KO
K02726  20S proteasome subunit alpha 2 [EC:3.4.25.1]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03050  Proteasome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    403015 (si:rp71-45k5.4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dre01002]
    403015 (si:rp71-45k5.4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:dre03051]
    403015 (si:rp71-45k5.4)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     403015 (si:rp71-45k5.4)
Peptidases and inhibitors [BR:dre01002]
 Threonine peptidases
  Family T1: proteasome family
   403015 (si:rp71-45k5.4)
Proteasome [BR:dre03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    403015 (si:rp71-45k5.4)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 403015
NCBI-ProteinID: NP_001122146
ZFIN: ZDB-GENE-060503-941
Ensembl: ENSDARG00000035679
Vega: OTTDARG00000015693
UniProt: B3DG31
Position
19
AA seq 234 aa
MAERGYSFSLTTFSPSGKLVQIEYALAAVAAGAPSVGIKASNGVVLATEKKQKSILYDEQ
SVHKVEPITKHIGMVYSGMGPDYRVLVRRARKLAQQYFLVYQEPIPTGQLVQRVASVMQE
YTQSGGVRPFGVSLLIAGWDEDRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLSPAEVKDYLAAIA
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcagaacgaggatacagtttttctctcacaacatttagcccgtctggcaaactggtg
cagattgaatatgctctggccgcagtagcagctggtgccccgtctgtaggaatcaaagca
tcaaatggagttgtgctggcaacagagaagaaacaaaagtccatactgtacgatgaacag
agcgtgcacaaagttgaaccgataaccaaacacattggcatggtgtacagtggaatgggc
cccgattacagggtgctggtcagaagggcaagaaagctggctcagcagtatttcctggtc
tatcaagagccgatccccacaggccagctggtacagagagtggcttctgtcatgcaagaa
tacacacagtcaggaggtgtacgcccatttggagtgtctctccttatcgctggttgggac
gaagacagaccatacttatttcagtcagacccatcgggagcatacttcgcttggaaagcc
acagcaatgggaaagaactatgtgaatggaaaaacgttccttgaaaaaagatataatgaa
gatctggaacttgaagatgctatacacactgccatcttaactttgaaggaaagttttgaa
ggtcagatgacagaagacaacattgaggtgggcatttgtaatgaagcagggtttcgcaga
ctgtcgcccgctgaggtgaaggattacctggcagcaattgcttaa

DBGET integrated database retrieval system