KEGG   Danio rerio (zebrafish): 403129
Entry
403129            CDS       T01004                                 
Symbol
frmpd4
Name
(RefSeq) FERM and PDZ domain-containing protein 4 isoform X1
  KO
K23956  FERM and PDZ domain-containing protein 4
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    403129 (frmpd4)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Other domain-containing proteins
  FERM domain-containing proteins
   403129 (frmpd4)
SSDB
Motif
Pfam: FERM_M PDZ PDZ_6 PDZ_2 FERM_f0 FERM_F2 Jak1_Phl
Other DBs
NCBI-GeneID: 403129
NCBI-ProteinID: XP_021334733
ZFIN: ZDB-GENE-121004-1
Ensembl: ENSDARG00000075685
Position
9:54039437..54129172
AA seq 1208 aa
MDVFSFVRMPKLAGHRTKSPCCPPPAPGGWAPAQGPPNGWEMSLSREARDCYVNHLSQSS
SLEEVRVDVEKFVPPAPRKVEMRRDPVLGFGFVAGSEKPVVVRSVTPGGPSEGKLIPGDE
IVMINEEPVSSAPRERVIDLVRSCKESIILTVVQPYPSPKSAFISAAKKAKLKSNPVKVR
FAEEVIINGQVPESVKDNSLLFMPNVLKVYLENGQTKSFKFDCNTSIKDVILTLQEKLSI
KSIEHFSLMLEHKVEGSATKLMLLHEQEMLTQVTQRPGSHKMKCYFRISFLPKDPVDLLR
RDAAAFDYLYVQSCKDVVQERFGSELKYDTALRLAALQMYILTLSTKHTQKVSLKYIEKE
WGLAQFLPPAVLSSMKEKNIKKALTHILKTNQNLVPPGKKLTALQAKVHYLKYLSDLRLY
GGRVFKSTLVQGEKHTEVTLLVGPRYGISHVINTKTNLVALLADFSHVNRIEMYTEDERN
VRVELHVLDVKPITLIMESSDAMNLACLTAGYYRLLVDSRRSIFNMANNSNTAGHDTRIK
HNYQAIDWNYGTCGGCNEPHPEYAVCGRRECDISPSEIHQAHHMHGDEKAERQSRGSHMH
AQPYFNIPKGKPQESPRSAKVSFIFGDPPLDSVNPQNLGYHRLMEDIPEVLEEHRYLYAQ
QKDYKPLEASLEVDGFQYGTHMVYGDAKIFGTTEGIEEPLLHDICYAETTDDAEDDDDIS
CEEDMMMMMGEMKDKANSLLSLSESSDDIIDLTSLPPPPEGDYEEDSDDLLESLNLAIAA
PPPGFRDSSDEDDHHDRKMAKNDIPVSLIDSVPTQVAGGSEEVFNDAVVSTLQALEALAA
SEDQSHPQSDNSSGVEISRSFSPESSSDSGNETNSSEMTESSELAAAQKLSENSLKMFVA
TAEGYQTLAEEETEFRLAPSLDDPQSSAVANLRSDHFEMEPETMETKSLTEYFSKMHRDV
MRGMAQGKVEEQDSGMKSSAEAAARQLNIAESEDLVGMYSNFNGRDSQCSAPFDMESMSY
AFQGSNQRLHMILNNKSEEHIYSEVAGDSAPLHADRVAQKVSLEDSIDLNASSPAKEQYL
VERARSEHQQSKGASSEQEVTRLYEYHLSKRMSSLQSEGVHSLQSSQCSSIDAGCSTGSS
NCVTPMDSPLCTVDSVHLHTESSMKGLGYTNQNVDGTFLRKHHGQAGAESGREGSQRLPK
IRETTDIG
NT seq 3627 nt   +upstreamnt  +downstreamnt
atggacgtgttcagcttcgtcaggatgcccaaactggcaggtcacaggaccaaatccccc
tgctgtccaccgccggcccccgggggttgggctcccgctcagggccctcccaatggctgg
gagatgtcgctgtctagagaggcccgagattgctacgttaatcacctctcgcagtccagt
tctctggaggaggtgcgcgttgatgtggagaagtttgtccctccggcaccgaggaaggtg
gagatgagacgagacccggtgctcggctttggcttcgtggcgggcagtgagaaacctgtc
gtggttcgatctgttactccaggagggccttcagaaggaaagctgatcccaggagatgaa
atagtgatgataaatgaggaacccgtgagttcggctccaagggaacgagtgatcgaccta
gtcaggagctgtaaggagtccatcatcctgacggtggtgcagccgtatccttctcccaaa
tctgccttcatcagtgcagctaaaaaggccaagttgaaatccaatccggtcaaagtgcgc
tttgctgaagaagtcattattaatggacaagtgccggagtcggtgaaggataattctctg
ctcttcatgccaaacgtgttgaaggtttatctggaaaacggacaaaccaaatccttcaag
tttgactgcaacacctccattaaggatgttattctgacgctgcaagagaagctgtctatt
aaaagcatcgagcacttctctctgatgctggagcacaaggtggaaggatctgcaacaaaa
ctgatgcttttacacgaacaggagatgctaacgcaggtgactcagaggccgggctcacat
aagatgaagtgttatttccgcatcagtttccttcctaaagatcctgtagatctgctgagg
agagacgctgctgcgtttgattatctctatgtgcagagctgtaaggatgtggtgcaggag
cgtttcggatcggagctgaaatacgacacagctcttcgtctcgctgctcttcagatgtac
atcctgacgctcagcaccaaacacacacagaaggtctcgctcaagtacattgagaaggaa
tggggtttggctcagtttctgcctccagccgttctgtccagcatgaaggagaagaacatc
aagaaggctctcacacacatcctgaagaccaaccagaacctggtgcctcctggcaaaaag
ctgacggcgttacaggcgaaggttcattatctgaagtatttgagtgacctgcggctgtat
ggaggacgagtgttcaagtctacactggttcaaggagagaaacacactgaagtaacgctg
ctggtgggaccaagatacggcatcagtcatgtgatcaacaccaaaaccaacctggtggct
cttctggccgacttcagccatgtgaaccgcatcgagatgtacaccgaggacgagaggaac
gtgcgggttgagcttcacgtactcgatgttaagcccatcacactcataatggagtccagt
gatgccatgaatctggcgtgtttgaccgcgggttactacagactgctggtggattcacgg
aggtccatcttcaacatggccaacaacagtaacactgcgggacacgacacgaggatcaag
cacaactaccaggcaatcgactggaattacggtacctgtggtggatgcaatgagcctcat
cctgaatacgccgtctgtggacgaagagagtgtgacatttcccccagtgaaattcaccag
gcgcatcatatgcacggggacgagaaagctgaaaggcagagcagaggaagccacatgcat
gctcagccctacttcaacatcccaaaaggcaaacctcaagaatcgcccagaagcgccaag
gtgtcgttcatatttggcgatcctccgctggactcggtgaacccccaaaatctgggatac
cacagactgatggaagacatcccagaggtcctggaggagcatcggtatttgtatgcacaa
cagaaggactacaaacctctggaagcgtcattggaggttgacggtttccaatatggtacc
catatggtatacggggacgccaagatcttcggtacgaccgagggcattgaggagcctctg
ctgcatgatatctgctacgccgaaactacagatgatgcagaagatgatgatgacattagt
tgtgaggaggacatgatgatgatgatgggagagatgaaggacaaagcgaactctctgttg
tcactttcagaatcaagtgatgatattattgaccttacttcgctgccaccaccgcctgaa
ggggactacgaggaggacagtgacgatctgttggagtcactaaatttggcaattgccgct
ccaccaccaggattcagagatagctcggatgaagatgaccaccatgatagaaaaatggcg
aaaaacgacatccctgtgtcgctgatcgattccgtgccgacgcaggttgctggtgggagc
gaggaagtgtttaatgatgccgttgtctcaacacttcaagcactagaggccctggcggcc
tcagaggatcagtctcatccacaatcagacaatagttcaggtgtagaaatatctcggtcc
tttagccccgagtcctcttctgattctgggaacgagacaaattcatctgaaatgacggag
agttcagagctggccgcagctcagaaactctccgaaaactctctgaaaatgtttgtagcc
acagcagaggggtaccaaactctagctgaggaggagactgaattccgcttggcaccatct
ctagatgatccccagtcctctgcggtcgccaatctccgctcagaccactttgagatggaa
ccggaaacaatggagaccaagtcattgacggagtactttagcaaaatgcacagggatgtg
atgaggggaatggcacaggggaaggttgaggagcaggacagcgggatgaaatccagtgca
gaagcagcagcccgacagttgaatattgcagaatctgaagatctggttgggatgtacagc
aacttcaatgggcgggattcccagtgttcggctccctttgacatggaaagtatgtcttat
gcctttcagggaagcaatcaaagattgcatatgattctgaataataaatctgaagagcac
atttactctgaggtggctggagacagcgctccattacatgcagacagggttgctcaaaag
gtcagtttggaggactcgatagacttgaatgcaagttcccccgccaaagagcagtatctg
gtcgagcgagcccggagtgaacaccaacaaagcaagggagcttcatctgaacaagaagtg
acccgtttgtacgagtaccacttgtccaaaaggatgtcatctttacagagcgagggtgtt
cattccctccagagttcccagtgttcgtccattgatgccggctgcagtacgggaagcagt
aactgcgttacaccaatggactctcctctgtgcacagtagatagtgtccatctgcatacc
gagtcctctatgaaaggtcttggatatacaaatcagaatgtagatggaacttttttgcgg
aagcaccacggacaggctggcgcagagtcaggtcgagagggaagccaaaggttgcccaag
atcagagaaactacagatattggataa

DBGET integrated database retrieval system