KEGG   Danio rerio (zebrafish): 403145Help
Entry
403145            CDS       T01004                                 

Gene name
myd88
Definition
(RefSeq) myeloid differentiation primary response protein MyD88
  KO
K04729  myeloid differentiation primary response protein MyD88
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04620  Toll-like receptor signaling pathway
dre04621  NOD-like receptor signaling pathway
dre05132  Salmonella infection
dre05168  Herpes simplex infection
Module
dre_M00686  Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    403145 (myd88)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    403145 (myd88)
   04621 NOD-like receptor signaling pathway
    403145 (myd88)
 09160 Human Diseases
  09167 Infectious diseases
   05132 Salmonella infection
    403145 (myd88)
   05168 Herpes simplex infection
    403145 (myd88)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death TIR TIR_2
Motif
Other DBs
NCBI-GeneID: 403145
NCBI-ProteinID: NP_997979
ZFIN: ZDB-GENE-040219-3
Ensembl: ENSDARG00000010169
Vega: OTTDARG00000021382
UniProt: Q5XJ85 B2GQ86
Position
24
AA seq 284 aa AA seqDB search
MASKLSIDHEAIPVTALNCSFRKKLGLFLNPTNTVAADWRTVAELMDFTYLEIKNFEKRD
CPFEKVLTDWETRPDATVANLLSILEKAERKDVISELKEILDDDCRKYMERQQRKPLQVP
VVDSCGPRTQEREGVTLYDDPQGLTPETFDAFICYCQSDIQFVHEMIKQLEHTEYNLKLC
VFDRDVLPGTCVWTIASELIEKRCKRMVVVISDDYLDSDACDFQTKFALSLCPGARTKRL
IPVVYKSMKRPFPSILRFLTICDYSKPCTQVWFWTRLAKALSLP
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaagttaagtatagaccatgaggcgattccagtaacagctttaaactgcagt
ttccgaaagaaactgggtctgttcctaaacccaacaaacactgtggcggcagactggagg
acagtggcagaactgatggacttcacgtacctggagatcaaaaacttcgagaaaagagac
tgtccctttgaaaaggtcttgacggactgggaaactcgtccagacgccacagtagcgaat
ttactgtcgattttagaaaaagctgaaaggaaagatgtcatatccgagctcaaagaaatt
ctagacgacgactgcaggaagtacatggaaagacaacagaggaaaccgcttcaggttcca
gtggtggacagttgtggacctcgaacacaggagagagaaggagtcacgctttatgatgat
ccacagggactgacacctgagacctttgatgctttcatctgctactgtcagagtgacatt
cagtttgtccacgagatgatcaaacagttggaacacaccgaatacaacctgaagctttgt
gtgtttgacagagacgtccttcctggcacatgcgtgtggaccatcgccagtgagcttatc
gaaaaaaggtgtaagaggatggtggtggtcatctctgatgattatctggatagtgatgcc
tgtgattttcagactaagtttgcgctcagtctttgcccaggagctcgcactaaacggcta
atccctgtcgtctacaaatccatgaagaggccgtttcccagcattctgcgctttctgacc
atctgtgattacagcaaaccctgcacacaggtctggttctggactcgactggccaaagca
ctttcactgccctaa

DBGET integrated database retrieval system