KEGG   Danio rerio (zebrafish): 405800Help
Entry
405800            CDS       T01004                                 

Gene name
dao.2
Definition
(RefSeq) D-amino acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00260  Glycine, serine and threonine metabolism
dre00330  Arginine and proline metabolism
dre00472  D-Arginine and D-ornithine metabolism
dre01100  Metabolic pathways
dre04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:dre00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    405800 (dao.2)
   00330 Arginine and proline metabolism
    405800 (dao.2)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    405800 (dao.2)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    405800 (dao.2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    405800 (dao.2)
Enzymes [BR:dre01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     405800 (dao.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO
Motif
Other DBs
NCBI-GeneID: 405800
NCBI-ProteinID: NP_999897
ZFIN: ZDB-GENE-040426-2634
Ensembl: ENSDARG00000035603
Vega: OTTDARG00000016080
UniProt: Q6NY97
Position
5
AA seq 348 aa AA seqDB search
MKVCIIGAGVIGLSTAQSIYQHFHSRVSPLTIEVYADIFTPLTTSDGAAGLWQPYLYDKG
NVKETQWNKDTFNYLLSFINSPDSVKMGIFLQSGYNLCAEPMPEPSFKQAVLGFRQLSKR
ELEMFPGYSFGWFNTALMIEGKTYLPWLMNWLKQRGVTFFQRTIDSFKELSDSGADMIIN
CSGVRSGDLQPDPELQPARGQIIKVDAPWLKHWVITHDSTSGVYDSPYIIPGSRLVTVGG
VFQVGNWNRMNSSVDHKGIWEAACKLEPSLQHARIVEDWTGLRPARSKVRLEREAIRSGG
HSFEVIHNYGHGGFGLTIHRGCAEEAARLFGQFLEQKGLLTAQAKSRL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgtgcatcattggcgcgggggtcatcggtctctccactgctcagagcatctac
cagcacttccacagcagagtctctcctctcaccatagaggtttatgctgatatttttact
cctctgaccaccagcgatggggcagctggactctggcagccctatctctacgacaagggc
aacgtcaaagaaactcaatggaacaaagacacgtttaactatctattgagtttcatcaac
tccccagattcagtgaaaatgggaattttccttcagtctggctacaatctgtgtgctgaa
ccaatgccggagccctcgtttaaacaagctgttttgggttttcgtcagctttctaaacgt
gaactagagatgttcccaggttacagttttggctggttcaacactgctctcatgattgaa
ggaaagacgtatttgccctggctcatgaactggttaaagcaaagaggcgtcacatttttt
cagaggacgattgactcatttaaagagttgtcagacagtggtgctgatatgatcatcaac
tgctctggtgttcgctcaggagatttgcagcctgaccctgagctccagccagccagagga
cagatcattaaggtagacgccccctggttaaagcactgggtcatcacgcatgattccaca
tcaggagtctatgattcaccgtacatcattcctgggagtcgtctggtcacagttggtgga
gttttccaagtgggaaactggaatcggatgaacagttcagttgaccataaaggaatctgg
gaagccgcctgcaaacttgagcccagtctacagcatgcacggatagtggaagactggact
ggtctcagacctgcacgcagtaaagtcagactggagagagaagccatacgatctggagga
cactcatttgaggtcatccataactatggacatggaggttttgggctgaccatccatcgt
ggatgtgctgaggaagctgctcggctctttggacagttcctggagcagaaaggattgcta
acagcacaagctaaatcacgcctttaa

DBGET integrated database retrieval system