KEGG   Danio rerio (zebrafish): 405822
Entry
405822            CDS       T01004                                 

Gene name
pgm2
Definition
(RefSeq) phosphoglucomutase-2
  KO
K15779  phosphoglucomutase / phosphopentomutase [EC:5.4.2.2 5.4.2.7]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00010  Glycolysis / Gluconeogenesis
dre00030  Pentose phosphate pathway
dre00052  Galactose metabolism
dre00230  Purine metabolism
dre00500  Starch and sucrose metabolism
dre00520  Amino sugar and nucleotide sugar metabolism
dre01100  Metabolic pathways
Module
dre_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
dre_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    405822 (pgm2)
   00030 Pentose phosphate pathway
    405822 (pgm2)
   00052 Galactose metabolism
    405822 (pgm2)
   00500 Starch and sucrose metabolism
    405822 (pgm2)
   00520 Amino sugar and nucleotide sugar metabolism
    405822 (pgm2)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    405822 (pgm2)
Enzymes [BR:dre01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     405822 (pgm2)
    5.4.2.7  phosphopentomutase
     405822 (pgm2)
SSDB
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Other DBs
NCBI-GeneID: 405822
NCBI-ProteinID: NP_998051
ZFIN: ZDB-GENE-040426-2218
Ensembl: ENSDARG00000018178
Vega: OTTDARG00000019400
UniProt: Q6NYE3
Position
1
AA seq 611 aa
MENGQGSTGDSRLDQAVTQWLQYDKNPKTAAAVRSMVKDGALSELQKCFGARMEFGTAGL
RAAMGPGVSCMNDLTIIQTTQGFCAYLEECFVDLKQRGVVIGFDARAHPPSGGSSKRFAC
LAACVLMSRGVPVHLFSDITPTPYVPFAVSHLGLCAGIMVTASHNPKQDNGYKVYWANGA
QIIPPHDKGIAAAIEQNLEPWPESWDTDEGLRSSLLNDPYQDIHREYCQTIQQHCFHREL
NRNTAVKIVHTSVHGVGHIFVQAAFKAFDLQPPYAVEEQKDPDPEFPTVKYPNPEEGEGV
LTLSFALADKEGASVILANDPDADRLAIAEKQESGKWRVFSGNELGALLGWWIFQCWKQQ
KVEGKGSIKDVYMLSSTVSSKILRAIAVKEGFHFEETLTGFKWMGNRARELMDQGKTVLF
AFEEAIGYMCSPAVLDKDGVSAAAIAGEFISYLASKNITLSHQLRSIYEEYGYHITKNSY
FICHNQDTIKKLFERLRNYGVDNSYPKECGGFAISAVRDLTTGYDSNQPNNKAVLPTSKS
SQMITFSFANGGVATMRTSGTEPKIKYYTELCAAPGNSDLNQLTKELDNLVDAIVEHFYQ
PEKNGLTPRPE
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggagaatggccaggggagcacaggggacagtcgtctggatcaagctgtcacgcagtgg
cttcagtatgacaagaatccaaagacggctgctgctgtgcggtcaatggttaaggatgga
gccttgtcagagctgcagaagtgtttcggggctcgtatggagtttggaaccgcaggactg
agagctgccatgggaccaggagtgtcctgcatgaatgacctcactatcatacaaaccacg
cagggtttttgcgcatacctggaggagtgttttgtggatctgaagcagaggggtgtagtt
atcgggtttgatgctcgtgctcaccctcccagcggcggcagtagtaaaagattcgcctgt
cttgctgcttgtgttctgatgagccgaggcgtcccagttcacctcttcagtgacatcaca
cctactccatatgtgccttttgctgtgtcgcatcttggactgtgtgctggtatcatggta
acagcctcccataatcccaaacaagataacggatacaaggtgtactgggcaaacggagct
cagatcattcctcctcatgataagggcatcgctgcagctatagaacaaaaccttgagccc
tggcctgaatcctgggacacagatgagggtcttcggagttcactgcttaatgacccatat
caggacatacacagagaatactgtcaaaccatccagcagcactgctttcacagggagctg
aataggaatacagcagtgaagattgtacacacatcagttcatggagtgggacatattttt
gtccaggctgcttttaaggccttcgatcttcagcctccatatgccgtggaagaacagaaa
gatcctgatccggagttccctaccgtcaaatacccaaaccctgaggagggagagggagtc
ctgacgctgtccttcgcgcttgcagataaagaaggagcaagtgttattctggcgaatgac
cctgacgctgacagactagctattgcagagaaacaggagagtgggaagtggagagttttc
tctgggaatgaattaggtgctttactcggctggtggattttccaatgctggaagcagcag
aaagtggaaggaaaaggctccattaaggacgtctacatgctatccagcacagtctcctca
aaaatcctcagagccattgcagtgaaagaaggctttcactttgaggagactcttacaggc
tttaaatggatgggaaaccgagccagagagttgatggaccaaggaaagactgttctgttt
gcctttgaagaagctattggttacatgtgttctcctgcagttttggacaaagatggtgtg
agtgcagctgctattgctggtgaattcatctcttacctggcatctaaaaacataactctg
tcccatcaactgagatccatttatgaagagtacggttaccacattaccaagaactcctac
ttcatctgtcacaaccaagacaccattaaaaagttgtttgagcgcctccgaaactacgga
gtggacaactcgtaccctaaagagtgtggaggttttgccatcagtgcagtgagagacctt
acaactggatacgacagcaaccagcccaacaacaaggccgttctgcccactagtaagagc
agtcagatgattaccttcagttttgctaatggtggtgtggctacaatgaggaccagtgga
acggagcctaagatcaaatactacactgaactctgcgctgcaccaggaaacagtgatctc
aaccagttgacaaaggagttggataacctggttgatgccatcgtggagcacttctaccaa
cctgagaaaaacggcctgactccccgaccagagtga

DBGET integrated database retrieval system