KEGG   Danio rerio (zebrafish): 405890
Entry
405890            CDS       T01004                                 

Gene name
esrrga
Definition
(RefSeq) estrogen-related receptor gamma a
  KO
K08554  estrogen-related receptor gamma
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    405890 (esrrga)
   03029 Mitochondrial biogenesis [BR:dre03029]
    405890 (esrrga)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:dre03310]
    405890 (esrrga)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    405890 (esrrga)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    405890 (esrrga)
Nuclear receptors [BR:dre03310]
 3. Estrogen like
  3B. Estrogen-related receptor
   405890 (esrrga)
SSDB
Motif
Pfam: Hormone_recep zf-C4 GAT
Other DBs
NCBI-GeneID: 405890
NCBI-ProteinID: NP_998119
ZFIN: ZDB-GENE-030821-2
Ensembl: ENSDARG00000004861
Vega: OTTDARG00000028830
UniProt: Q6Q6F4
Position
17
AA seq 435 aa
MSNKDRHIESSCPSYIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPT
LYGPTGALGPSGTGAKRYEDCSSTITEDSQIKCEYMLNSMPKRLCLVCGDIASGYHYGVA
SCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLTVGMMREGVRLDRV
RGGRQKYKRRIDAENSPYLNPQLALPPKKPYNKIVSHLLVAEPEKIYAMPDPTVPDSDIK
ALTTLCDLADRELVVNIGWAKHIPGFSTLSLADQMSLLQSAWMEILILRVVYRSLSFEDK
LVYAEDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALANSDSMHIE
DVEAVQKLQDVLHEALQDYEAGQHVEDPRRAGKLLMTLPLLRQTSTKAVQHFYSIKQDGK
VPMHKLFLELLEAKV
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgtccaacaaggaccgccacattgagtcgagttgcccctcctacataaagactgaacct
tccagccccgcctcactaacggacagcgtaaatcaccacagccccggcggctcctcagac
gccagcggtagctacagctccaccatgaacggccatcagaacggcctggactcacccact
ctttatggcccaacaggcgctctgggtcccagcggaactggtgccaagcgttatgaggac
tgttccagcaccatcacagaggactcacagattaaatgcgagtacatgctgaactccatg
cccaagcgcctgtgcctggtgtgcggggacatcgcttctggttaccactatggcgttgcc
tcctgcgaggcctgcaaggcttttttcaagaggaccattcaaggaaacatcgagtacagc
tgccccgccaccaatgaatgtgagatcaccaaacgtagaaggaagtcctgccaagcctgc
cgcttcatgaagtgtctgaccgtcggcatgatgcgagaaggtgttcgactggaccgtgtt
cgcggtggaagacagaaatacaaacgccggatagatgcagaaaacagcccctatttgaac
cctcaactggctctgccacccaaaaagccatataacaagattgtgtctcacttgctggtg
gcggagccggagaagatctacgccatgcctgacccgacagtgcccgacagcgacatcaaa
gccctgaccacgctctgcgacctggcagaccgagagctggtggtcaacataggctgggcc
aagcatatcccaggcttttccacactgtcactggcggatcagatgagtcttctgcagagt
gcgtggatggagatcctgatcctacgtgtcgtctaccgctcactgtcttttgaggacaag
ttggtgtacgctgaggactacatcatggatgaggatcaatccaaactggcgggtctgctc
gacctgaataatgccattcttcagctggtgaagaagtacaagagcatgaagctggagaag
gaggagtttgtcactcttaaagctatagccctggctaattcagattccatgcatatagag
gatgtggaagctgtgcagaagctccaggatgtgttgcacgaggccctgcaggactatgag
gcaggtcaacatgtagaggacccgcgccgggccggcaagctgctcatgaccctaccactg
ctccggcaaacgtccaccaaggcagtgcagcacttctacagcatcaaacaggacggcaaa
gtgcccatgcacaaactgtttctggagctgctggaggccaaggtgtaa

DBGET integrated database retrieval system