KEGG   Danio rerio (zebrafish): 405897Help
Entry
405897            CDS       T01004                                 

Gene name
cdk7
Definition
(RefSeq) cyclin-dependent kinase 7
  KO
K02202  cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03022  Basal transcription factors
dre03420  Nucleotide excision repair
dre04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    405897 (cdk7)
  09124 Replication and repair
   03420 Nucleotide excision repair
    405897 (cdk7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    405897 (cdk7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dre01001]
    405897 (cdk7)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dre03021]
    405897 (cdk7)
   03019 Messenger RNA biogenesis [BR:dre03019]
    405897 (cdk7)
   03400 DNA repair and recombination proteins [BR:dre03400]
    405897 (cdk7)
Enzymes [BR:dre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     405897 (cdk7)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     405897 (cdk7)
Protein kinases [BR:dre01001]
 Serine/threonine kinases: CMGC group
  CDK family
   405897 (cdk7)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     405897 (cdk7)
Messenger RNA biogenesis [BR:dre03019]
 Eukaryotic type
  mRNA processing factors
   5' end processing
    Capping factors
     405897 (cdk7)
DNA repair and recombination proteins [BR:dre03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     405897 (cdk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Seadorna_VP7 Kinase-like Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 405897
NCBI-ProteinID: NP_998126
ZFIN: ZDB-GENE-010320-2
Ensembl: ENSDARG00000051916
Vega: OTTDARG00000018907
UniProt: Q2V6H0
Position
5
AA seq 345 aa AA seqDB search
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKTTNTIVAIKKIKVGHRTEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDYMETDLEVIIKDTSLVLTPANIKAYILM
TLQGLEYMHNHWILHRDLKPNNLLLDENGVLKLADFGLAKAFGSPNRVYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLAGDSDLDQLTKIFEALGTPTDEIWPGM
SSLPDYVSFKPFPGTPLEHIFSAAGDDLLELLRGLFTYNPCSRTTAMQALKMKYFSNRPG
PTPGPQLPRPNSSTEALKEKENLLIGIKRKRDSIEQGTLKKKLVF
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcattagatgtaaagtcaagggcaaagcgttatgaaaagctggactttttgggtgaa
ggacagtttgctactgtttacaaggcaagagacaaaaccacgaacaccattgtcgctatc
aaaaagataaaagtgggacacagaacagaggctaaagatggcatcaacagaacagctctt
cgagagattaagttgttgcaagagctcagtcatccaaacattattggtctcctggatgct
tttggacacaaatctaatattagtctggtctttgattacatggagacagatctcgaggta
atcataaaggacaccagtctcgtactgacacctgccaatataaaggcatacatcctcatg
acactacagggtctggaatacatgcacaatcactggatcctgcacagggatctgaaaccc
aataatttactgctggatgagaatggagtcttgaagcttgctgattttggcttagccaaa
gcatttggaagcccaaacagagtgtatacacatcaagttgtcacaagatggtatcgggct
ccagagctgctctttggtgccaggatgtatggtgtaggtgtggacatgtgggcagttggc
tgcattcttgctgagcttttactccgggtgccatttttagctggagattcagacttggat
cagctgacgaagatatttgaagctttgggaacaccaacagatgagatctggcctgggatg
tcgagtctcccagactatgtgtcatttaagccatttcctggcactccactggagcacatc
ttcagtgctgccggcgatgacctgctggagcttctgagggggttattcacctataacccc
tgctcacgcaccacagctatgcaggctttgaaaatgaagtatttcagcaatagaccagga
ccaaccccaggccctcaactacccagaccaaactcctcaacagaagccctgaaagagaaa
gaaaacctgctgataggaatcaagaggaaacgtgacagtattgaacagggtacccttaaa
aagaagctggtgttttaa

DBGET integrated database retrieval system