KEGG   Danio rerio (zebrafish): 406384
Entry
406384            CDS       T01004                                 

Gene name
gmfb
Definition
(RefSeq) glia maturation factor beta
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: Cofilin_ADF
Other DBs
NCBI-GeneID: 406384
NCBI-ProteinID: NP_998275
ZFIN: ZDB-GENE-040426-2114
Ensembl: ENSDARG00000028327
Vega: OTTDARG00000020872
UniProt: Q7ZUD3
Position
13
AA seq 142 aa
MSESLVVCEVDEDLVKKLRDFRFRKETNNAAIIMKIDKDKQLVILEEEHEDISPEDLKNE
LPERQPRFVVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTVELTKV
FEIRNTEDLTEEWLREKLGFFR
NT seq 429 nt   +upstreamnt  +downstreamnt
atgagtgagtcattagttgtgtgtgaggtggacgaggacctggtgaaaaagttgcgtgat
ttccgcttcaggaaggaaactaataatgccgccattatcatgaagattgacaaagacaaa
cagctggtaatcctggaggaggagcatgaggatatttctcctgaagacttgaagaatgag
ctgccagaaagacagcccagatttgtagtctacagctataagtaccagcatgacgatgga
agagtgtcctatccgttgtgtttcatcttctctagtcctgttggatgcaaacctgagcag
cagatgatgtatgctggcagcaaaaacaaactggtacagacagttgaactgaccaaggtg
tttgagatccgtaacactgaagacctgacagaggagtggctccgggagaaactaggattc
tttcgctaa

DBGET integrated database retrieval system