KEGG   Danio rerio (zebrafish): 406386
Entry
406386            CDS       T01004                                 

Gene name
rabggtb
Definition
(RefSeq) geranylgeranyl transferase type-2 subunit beta
  KO
K05956  geranylgeranyl transferase type-2 subunit beta [EC:2.5.1.60]
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:dre01006]
    406386 (rabggtb)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    406386 (rabggtb)
Enzymes [BR:dre01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.60  protein geranylgeranyltransferase type II
     406386 (rabggtb)
Prenyltransferases [BR:dre01006]
 Protein prenylation
  Rab geranylgeranyltransferase
   406386 (rabggtb)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    406386 (rabggtb)
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
    406386 (rabggtb)
SSDB
Motif
Pfam: Prenyltrans SQHop_cyclase_C
Other DBs
NCBI-GeneID: 406386
NCBI-ProteinID: NP_998277
ZFIN: ZDB-GENE-040426-2116
Ensembl: ENSDARG00000068587
Vega: OTTDARG00000021568
UniProt: Q4V946
Position
2
AA seq 331 aa
MGTQVKDVTIKPDAPNTLFLDKHADYIAAYGSKKDDYEYTLSEYLRMSGIYWGLTVMDLM
GQLSRMNREEIIEFIKSCQHDCGGISASIGHDPHLLYTLSAIQILSLYDSVNAIDVDKVV
EYVKGLQQEDGSFAGDKWGEIDTRFSFCAVATLALLGKLDVINVDKAVEFVMSCMNFDGG
FGCRPGSESHAGQIYCCTGFLSVTGQLHQVNADLLGWWLCERQLPSGGLNGRPEKLPDVC
YSWWVLASLKIIGRIHWIDKAKLRNFILACQDEETGGFADRPGDMVDPFHTLFGVAGLSL
LGDEQIKPVNPVFCMPEDVLQRIGLQPDLLS
NT seq 996 nt   +upstreamnt  +downstreamnt
atggggacccaggtgaaagacgtgaccattaagcctgatgctcctaacactctcttccta
gacaagcatgcagactatattgcagcttatggttcaaagaaggatgattatgagtacaca
ctgtcagagtatctgagaatgagtggcatctactggggtcttaccgtgatggacctgatg
ggtcaactgtcccgaatgaaccgagaggagattatagagttcatcaaatcctgccagcac
gactgcggaggcatcagcgcaagcatcggtcatgaccctcatctcctttacactttaagt
gctatacagattctgtccttgtatgatagtgttaatgccattgatgtggataaagtggtg
gaatatgttaaaggactgcagcaagaggatggctcgtttgcaggggacaaatggggtgaa
atagacacacgtttttccttttgtgcagttgcaactttggcactactgggaaaactggat
gtgatcaacgtagacaaggccgtagagtttgtgatgtcctgtatgaactttgacggtggg
tttggttgcaggcctggttcagagtctcatgctggtcagatttactgctgcacaggtttc
ttgtctgtcactgggcagcttcatcaagtcaatgcagatctgttgggctggtggctctgt
gaaagacagctgccatcaggaggactgaatgggaggccagagaagctgcctgatgtctgc
tattcctggtgggttcttgcctcattgaaaatcattggcagaattcactggattgacaaa
gcaaaactgcgcaattttattcttgcctgccaggatgaagagaccggaggctttgctgac
aggcctggagacatggtggatcctttccacactctgtttggtgtagccggtctgtctctg
cttggagatgagcagatcaagccagtgaaccctgtgttttgcatgcctgaggatgtgctt
cagaggattggcctccaaccagacttactgagctga

DBGET integrated database retrieval system