KEGG   Danio rerio (zebrafish): 406438Help
Entry
406438            CDS       T01004                                 

Gene name
sumo1
Definition
(RefSeq) small ubiquitin-related modifier 1 precursor
  KO
K12160  small ubiquitin-related modifier
Organism
dre  Danio rerio (zebrafish)
Pathway
dre03013  RNA transport
Brite
KEGG Orthology (KO) [BR:dre00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    406438 (sumo1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    406438 (sumo1)
   03029 Mitochondrial biogenesis [BR:dre03029]
    406438 (sumo1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dre04812]
    406438 (sumo1)
Ubiquitin system [BR:dre04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   406438 (sumo1)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    406438 (sumo1)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    406438 (sumo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rad60-SLD ubiquitin
Motif
Other DBs
NCBI-GeneID: 406438
NCBI-ProteinID: NP_998324
ZFIN: ZDB-GENE-040426-2186
Ensembl: ENSDARG00000044267
Vega: OTTDARG00000019764
UniProt: Q7SZR5
Position
6
AA seq 100 aa AA seqDB search
MSDTETKPSSDGGEKKDGEYIKLKVIGQDNSEIHFKVKMTTHLKKLKESYSQRQGVPVNS
LRFLFEGQRITDNLTPKELGMEDEDVIEVYQEQTGGCRND
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacacggagaccaagccctcaagtgatggaggcgagaagaaggatggagagtac
attaaactcaaagtgatcggtcaggacaacagtgaaattcactttaaagtgaagatgacg
acacatttaaagaagctgaaggaatcctacagtcagagacagggtgtacccgtgaactct
ctaaggtttctctttgagggacagagaatcacagacaacctgacccccaaagagctggga
atggaagatgaggacgtgatcgaggtgtatcaggaacagactggaggctgtcggaacgac
tag

DBGET integrated database retrieval system