KEGG   Danio rerio (zebrafish): 406452
Entry
406452            CDS       T01004                                 

Gene name
sqstm1
Definition
(RefSeq) sequestosome-1
  KO
K14381  sequestosome 1
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04137  Mitophagy - animal
dre04140  Autophagy - animal
dre04217  Necroptosis
dre04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    406452 (sqstm1)
   04137 Mitophagy - animal
    406452 (sqstm1)
  09143 Cell growth and death
   04217 Necroptosis
    406452 (sqstm1)
   04218 Cellular senescence
    406452 (sqstm1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    406452 (sqstm1)
   03029 Mitochondrial biogenesis [BR:dre03029]
    406452 (sqstm1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    406452 (sqstm1)
Membrane trafficking [BR:dre04131]
 Autophagy
  Mitophagy
   Cargo receptors
    406452 (sqstm1)
  Pexophagy
    406452 (sqstm1)
  Aggrephagy
    406452 (sqstm1)
  Xenophagy
    406452 (sqstm1)
  Other autophagy associated proteins
   Midbophagy associated proteins
    406452 (sqstm1)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    406452 (sqstm1)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   406452 (sqstm1)
SSDB
Motif
Pfam: UBA_5 ZZ PB1 C1_2 Secretin_N_2
Other DBs
NCBI-GeneID: 406452
NCBI-ProteinID: NP_001299842
ZFIN: ZDB-GENE-040426-2204
Ensembl: ENSDARG00000075014
Vega: OTTDARG00000027873
UniProt: F1Q5Z8
Position
14
AA seq 452 aa
MSMTVKAYLIGKEDCNKEIRRFAVDQDVSTSFEYLQRKVLDVFVGLRTAPFQMYYKDEDG
DMIAFSSDDELMMGLALVKDDTFRLFIKQRKEHKRDSSPHGIPGFPFTTPHFSPPGPCHM
GPSPMGPPGPPHMGGPPHHPHPMVHPGVTCDGCDGPVAGTRYKCTVCPDYDLCPTCQSKG
LHKEHALLPIFHPMANVFEWLPRGKFWRKMRHCMWANAQAQAQNQPQPGPSGAQQNQDAP
ENPNENGATASSQANVEYLKNIGEEVAAMLSPLGIDVDIDVEHEGKRTKVTPTPPASSGP
SSARSDSGSVGLLSRGSGPGSQATEESVSEGTKKDQCSDEEWTHLSAKEVDPSTGELQSL
RLEQDGADLPAPLNTASGTSTRDGPTGLREAALYPHLPQDADPRLVESLSQMLSMGFTDE
GGWLTRLLHTKNYDIGGALDTIQYSKTPGQQK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgtcgatgacagtgaaagcttaccttatcggtaaggaggactgcaacaaggagatccgt
cgcttcgccgtggatcaagatgtctcaacaagtttcgagtatttgcagcgaaaagtgctc
gatgtttttgtcggtctcaggactgcgcccttccaaatgtactataaagatgaagatggt
gatatgattgccttttcctctgacgatgagctaatgatgggtttggctcttgtgaaggat
gacactttccgtctcttcatcaagcaacgaaaagagcacaaacgtgattcttctcctcat
ggaattcctgggtttccgttcactacacctcactttagccctcctggtccctgtcatatg
ggtccatctccaatggggcctccaggaccacctcatatggggggtcctcctcaccaccct
cacccaatggtgcacccaggtgtgacctgtgacgggtgtgatgggccggtggctggaacc
cgttacaagtgcaccgtttgccccgattatgacttgtgccccacctgccagagcaaaggc
ctgcacaaggagcatgccctcctgcccatctttcatcctatggccaacgtgtttgagtgg
ctccctcgtgggaaattttggcgtaagatgagacactgcatgtgggcaaatgctcaagct
caggctcaaaaccagcctcagccaggtccatctggagcgcagcaaaaccaggatgctcct
gaaaacccaaatgagaatggtgctactgcctcttctcaggctaacgtggagtacctaaag
aacatcggagaagaagtggcagccatgttaagcccccttggcatagatgtggacatcgat
gttgagcatgagggaaagcggaccaaagtaaccccaactcctcctgcctccagtggacca
tccagtgctcggagtgacagtggttctgtggggcttctttctagaggctctggtccagga
agtcaggccactgaagagagcgtcagtgagggaacaaagaaagaccaatgtagtgatgag
gaatggactcatcttagtgctaaagaggtggatccttcgacaggagagctgcagtctctt
agactagagcaggacggggcagatcttccagctccactaaatactgcttctggcacaagc
accagagacggtcccactggtctgcgcgaggcagctctctacccacaccttcctcaagat
gcagaccctaggctggtggagtctctgtctcagatgctctccatgggtttcaccgatgag
ggtggatggctaaccagactgctccacaccaagaattacgacatcggtggtgctctggac
accatccagtactccaaaacaccaggacaacagaagtag

DBGET integrated database retrieval system