KEGG   Danio rerio (zebrafish): 406466Help
Entry
406466            CDS       T01004                                 

Gene name
map1lc3a
Definition
(RefSeq) microtubule-associated proteins 1A/1B light chain 3A
  KO
K10435  microtubule-associated protein 1 light chain
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    406466 (map1lc3a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    406466 (map1lc3a)
   03029 Mitochondrial biogenesis [BR:dre03029]
    406466 (map1lc3a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dre04812]
    406466 (map1lc3a)
Membrane trafficking [BR:dre04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    406466 (map1lc3a)
Mitochondrial biogenesis [BR:dre03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    406466 (map1lc3a)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     406466 (map1lc3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Atg8 APG12 Cytochrom_B559a
Motif
Other DBs
NCBI-GeneID: 406466
NCBI-ProteinID: NP_999904
ZFIN: ZDB-GENE-040426-2232
Ensembl: ENSDARG00000033609
Vega: OTTDARG00000035319
UniProt: Q6NX90
Position
11
AA seq 121 aa AA seqDB search
MPSDRPFKQRRSFADRCKEVQQIREQHPNKIPVIIERYKGEKQLPVLDKTKFLVPDHVNM
SELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPISEIYEQERDEDGFLYMVYASQETFG
C
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgccatccgacagacccttcaaacaacgacggagcttcgctgatcgttgcaaggaagtg
cagcagatacgagagcagcatcctaataaaattccggtgatcattgagaggtataagggg
gaaaagcaacttccagtcttggacaagaccaagttccttgtccctgaccatgttaacatg
agtgagctggtaaagattatcaggcgtcgactgcagctcaaccccacccaggcctttttc
cttcttgtcaatcagcacagcatggtcagcgtgtccacccccatttctgagatctacgaa
caagagcgtgacgaagacggcttcctttacatggtttacgcctcccaggagaccttcggc
tgctaa

DBGET integrated database retrieval system