KEGG   Danio rerio (zebrafish): 406471Help
Entry
406471            CDS       T01004                                 

Gene name
tnfrsf1a
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A precursor
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04010  MAPK signaling pathway
dre04060  Cytokine-cytokine receptor interaction
dre04150  mTOR signaling pathway
dre04210  Apoptosis
dre04217  Necroptosis
dre04920  Adipocytokine signaling pathway
dre05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    406471 (tnfrsf1a)
   04150 mTOR signaling pathway
    406471 (tnfrsf1a)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    406471 (tnfrsf1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    406471 (tnfrsf1a)
   04217 Necroptosis
    406471 (tnfrsf1a)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    406471 (tnfrsf1a)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    406471 (tnfrsf1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:dre04050]
    406471 (tnfrsf1a)
   04090 CD Molecules [BR:dre04090]
    406471 (tnfrsf1a)
Cytokine receptors [BR:dre04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   406471 (tnfrsf1a)
CD molecules [BR:dre04090]
 Proteins
  406471 (tnfrsf1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death
Motif
Other DBs
NCBI-GeneID: 406471
NCBI-ProteinID: NP_998355
ZFIN: ZDB-GENE-040426-2252
Ensembl: ENSDARG00000018569
Vega: OTTDARG00000022106
UniProt: Q6NUU6
Position
16
AA seq 389 aa AA seqDB search
MRICQLTTCLFLVLTSQLYTISGLGGNKTMKGNCLENEYWNKEGFCCDKCHQGYKLKQEC
SAENMRSKCEKCDEGTYLEQANYSPNCFRCQQCTKPHSRESSPCTPYSNRVCECDTDYYK
KKLGDLGWECSRCKKCGDGQIEIQNCTKEENRQCKCQENHYPFNKNSCKLCDKCQPGCDH
LCKTSIPPVFFTSTKSNSPEDTVPKIVVPVCASIMVLSLAIFMAYEGIRHWRKRAQASSS
QSSSPATEEEAFIITVVQDSKNKSVSFTNQPCESKPLGNLPDCIPREIKIHEFFYFVLDE
VPIGRFKELVRRLGVSEQNIDRAEHDHRNCKDAQYQMLKVWSDGGSGGGNNVVPYDQIQM
LMSTLKDMCLVSCADNIENKFLSQNTSVS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaggatatgtcaactgaccacgtgtttgtttctggttctaaccagccagttatataca
atatcaggacttggtggaaacaagactatgaagggaaattgtcttgaaaatgaatactgg
aataaggaaggattctgctgtgataaatgccatcaagggtacaagttaaaacaggaatgc
agtgcagaaaacatgaggtcaaaatgtgagaaatgtgatgaaggaacctacctggaacaa
gcaaactatagcccaaactgcttcagatgccagcaatgcacaaaaccccattccagggag
tcttcaccctgcacaccctactccaacagggtgtgtgaatgtgatactgattattacaag
aagaagctaggtgatttaggatgggaatgctctcgctgtaaaaagtgtggagatgggcaa
attgaaattcagaactgcactaaggaagagaatagacagtgcaaatgccaggaaaatcat
tacccttttaataaaaactcctgtaagctgtgcgataaatgtcagccaggatgtgatcac
ctatgcaaaaccagcattcccccagtcttttttacatctactaagtcaaatagtcctgaa
gacacggtacctaaaatagtagttcctgtttgtgcaagtatcatggttctatcgttagcc
atttttatggcatacgaaggcatcagacattggcggaagagggcacaagcttcgtcatct
cagtcatcgtcacctgctacagaagaagaggcattcatcatcactgtagtgcaggactca
aaaaataagagcgtatcattcacaaatcagccatgtgaatccaaacctctagggaatctc
ccagactgcatcccaagagagatcaaaattcacgagttcttctattttgtgctggacgag
gtccctatcggacgatttaaagagcttgtacgtcggcttggagtttctgagcagaacatt
gaccgggcagaacatgaccaccggaactgcaaggacgcccagtatcagatgctgaaagtt
tggagtgatggtggcagtggaggagggaacaatgttgtgccgtatgaccaaatccagatg
ctcatgagcacactgaaagacatgtgtctggttagctgcgcagataacattgagaacaag
ttcctttcacagaacacaagcgtttcgtaa

DBGET integrated database retrieval system