KEGG   Danio rerio (zebrafish): 406581
Entry
406581            CDS       T01004                                 

Gene name
gkap1
Definition
(RefSeq) G kinase-anchoring protein 1
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: HIP1_clath_bdg
Other DBs
NCBI-GeneID: 406581
NCBI-ProteinID: NP_998237
ZFIN: ZDB-GENE-040426-2485
Ensembl: ENSDARG00000068123
Vega: OTTDARG00000028921
UniProt: Q6NWC9
Position
8
AA seq 368 aa
MASAVISVPTTASRFALLQVDSDSDSDSDVGKPKAAGRGAGKPRSGKSPSGKNSQNNEKK
KEKRRRKKEQQQSEANELRSLAFKKIPQKSTAPPSLTLQDLANDLINPANVQQGSKPQEN
WQEWKQRDEQLTSDLYEADLEKALMLSKLEFEEHKKDADKAETASPKTKTGGKKDRKKNQ
QGKDKRVTVSLKDFQQEDQLKNKPEREPVNPALRDDKFFNKLEDDVSKIVQRDKRREQYS
NSAGQEVNTSSEHEQDVRTEQLKYELEKKDQEIAKLKKTISQWEERYKEVKARNSQLLKM
LQQGEMKDKAEILLQVEELLNIKEELSSQVTQLHTALEQERSKVKGLQSEQPKHQGNRKG
KKASEGDV
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggcatcagcagtgatctccgtgcccaccaccgcctcacgcttcgccctgctgcaggtc
gactctgattcggactcagattcagatgtaggaaagccgaaggcggcgggtcgaggagca
gggaagccccggtcggggaaatcgcctagcgggaagaacagccaaaataacgagaaaaag
aaggaaaagaggagacggaagaaggaacagcagcagagtgaagctaatgagctcaggagt
cttgcttttaagaagatccctcagaagtcgacagcgcctccttcactcacgctccaggat
ttagcgaatgatctgatcaatccggcaaatgtccagcaaggctccaaaccgcaggaaaac
tggcaggagtggaagcagagagatgaacagctgaccagtgacctgtatgaggcggatctg
gaaaaggccttgatgctaagtaaattggagtttgaggaacataaaaaggatgctgacaaa
gctgagacggcgtcaccaaagacgaagactggtggaaagaaggacaggaagaagaaccag
caggggaaggacaaacgtgtcaccgtgtctctgaaagacttccagcaggaggatcagctg
aagaacaagcctgagcgagagcctgtaaatccagcgctccgcgatgacaagttctttaac
aagctagaggatgacgtgagtaaaatcgtccagcgcgacaaacgcagagagcagtacagc
aacagcgccgggcaggaggtcaacacgtcctcagagcacgagcaggatgtgagaactgag
cagctgaaatacgaactggagaagaaagaccaggaaatcgcaaagttgaaaaagacaatt
tcacaatgggaggaaagatataaggaagtcaaggccagaaattcccagctattgaaaatg
cttcagcaaggagaaatgaaggacaaagctgaaattctgctgcaggtggaggagctgctc
aacattaaagaggagttgtcctcacaggttacacaattacacacagctctggagcaggag
agatcgaaagtgaagggcttacagtcagaacaacccaaacatcaggggaaccggaagggt
aaaaaagcctcagaaggggatgtatga

DBGET integrated database retrieval system