KEGG   Danio rerio (zebrafish): 406681
Entry
406681            CDS       T01004                                 

Gene name
actr1b
Definition
(RefSeq) actin related protein 1B
  KO
K16575  centractin
Organism
dre  Danio rerio (zebrafish)
Pathway
dre05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:dre00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    406681 (actr1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dre03036]
    406681 (actr1b)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:dre04812]
    406681 (actr1b)
   04147 Exosome [BR:dre04147]
    406681 (actr1b)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Dynactin complex
     406681 (actr1b)
Cytoskeleton proteins [BR:dre04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actin-related proteins
     406681 (actr1b)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   406681 (actr1b)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 406681
NCBI-ProteinID: NP_998537
ZFIN: ZDB-GENE-040426-2695
Ensembl: ENSDARG00000011611
Vega: OTTDARG00000008461
UniProt: Q7ZUZ2
Position
10
AA seq 376 aa
MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHVRVMAGALEGDLFIGP
KAEEHRGLLSVRYPMEHGIVKDWNDMERIWQYVYSKEQLQTFSEEHPVLLTEAPLNPSKN
RERAAEVFFETFNVPALFISMQAVLSLYATGRTTGVVLDAGDGVTHAVPIYEGFAIPHSI
MRVDIAGRDVSRYLRLLLRKEGYDFHTSAEFEVVRTIKERACYLSLNPQKDETLETEKAQ
YTLPDGSTLDIGPARFRAPELLFRPDLIGDESEGIHEVLAFAIQKSDMDLRRTLFSNIVL
SGGSTLLKGFGDRLLSEVKKLAPKDVKIKISAPQERLYSTWIGGSILASLDTFKKMWVSK
KEYEEDRARAIHRKTF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atggagtcgtatgatattatagccaaccagccggttgtgattgataatgggtcgggagtt
atcaaggcaggctttgctggagatcagatccccaaatactgttttccaaattatgtgggt
cgacccaagcatgttcgggtgatggctggtgcactggaaggcgatctgtttattggacct
aaagcagaggagcaccggggtctgctgtctgttcggtacccaatggaacatgggattgtg
aaagactggaacgacatggagcgcatctggcagtacgtgtactcgaaggagcagctgcag
accttctctgaggagcatcctgtactgttgacggaagccccgctgaaccccagtaaaaac
cgtgagcgagcagcagaggtgttcttcgagaccttcaacgtgcctgcgctcttcatctcc
atgcaggcggttctcagtttatacgccacaggccgaaccacaggtgtggtgctggacgct
ggtgacggtgtgactcacgccgtgcccatatacgagggattcgccattcctcactccatt
atgcgtgtggatatagctggacgggacgtctcccggtacctccgtctcctcctgcgcaag
gaaggctatgatttccacacctctgcagagtttgaggtggtgcgcaccatcaaggagaga
gcctgctacctctccctcaaccctcagaaggatgaaactctagaaactgaaaaagcacag
tataccctccctgacggaagcactctagatatcggccctgcgcggtttagggctccggag
cttctcttcaggccagatctgattggagacgagagcgagggcattcatgaggtgctggcc
ttcgccattcagaagtccgacatggatctgcgacgcacgctcttctcaaacatagtgctg
tccggaggctcgacgctcctcaaaggttttggagaccggttgttaagcgaagtgaagaaa
cttgcccccaaagacgttaaaattaagatatctgcaccgcaggagagactttactcaaca
tggatagggggatccatcctagcatcactcgacacctttaagaaaatgtgggtctccaag
aaggaatacgaggaagatcgtgcgcgcgccattcaccggaagacattttaa

DBGET integrated database retrieval system