KEGG   Danio rerio (zebrafish): 406713
Entry
406713            CDS       T01004                                 

Symbol
lipf
Name
(RefSeq) gastric triacylglycerol lipase precursor
  KO
K01052  lysosomal acid lipase/cholesteryl ester hydrolase [EC:3.1.1.13]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00100  Steroid biosynthesis
dre04142  Lysosome
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    406713 (lipf)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    406713 (lipf)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.13  sterol esterase
     406713 (lipf)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydro_lipase Hydrolase_4 Abhydrolase_6 Esterase VirJ DUF900 Abhydrolase_2 FSH1 Mbeg1-like DUF676
Other DBs
NCBI-GeneID: 406713
NCBI-ProteinID: NP_998569
ZFIN: ZDB-GENE-040426-2737
Ensembl: ENSDARG00000018529
Vega: OTTDARG00000020543
UniProt: Q7ZTR9
Position
12:complement(17158642..17201028)
AA seq 396 aa
MLWLVLSLVILTSGLVQYGQSALDGTGLDPEVNMNISEIIRHWGYPAEEFEVVTEDGYIL
SINRIPHGVKNKNEEVKPVVFLQHGLLAAGSNWVTNLPNNSLGFVLADAGFDVWIGNSRG
NTWSCKHVSLDPRQKEYWKFSHDEMAKKDLPAVINFITKMTGQEQIFYVGHSQGTTIAFM
AFSTMPELASKIKMFFALAPVATVGMTKSPMTKLSVIPEFLIWDLFGQKDFFPQNELIKF
FATEFCSRKPLSVLCGNVFFLLCGFDEKNLNMSRTPVYTAHCPAGTSVQNMIHWAQAVKS
SKLMAYDYGRAGNMAHYNQSTPPLYNIQDMMVPTAVWSGGQDTLADPKDVALLLTQIPKL
VYKRDIKHWEHLDFIWGMDAPQEMYEKMIEIMRENV
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgttatggctggtgttgtctttggtaatacttacatctggactggttcagtatggacag
tcggctctggatgggacaggattggaccccgaagttaacatgaacattagtgaaattatc
agacactggggttaccctgctgaagaatttgaggtggtcactgaagacggatacatcctg
agcatcaaccgaatcccacatggagtcaaaaacaaaaacgaagaagtcaagcctgtagtg
tttctccaacacggtcttctcgctgctggaagtaactgggtgacaaacctgcccaacaac
agtctgggattcgttttagctgatgctggatttgatgtatggatcgggaacagtcgcggg
aacacctggtcctgcaaacatgtcagccttgacccaagacagaaagaatactggaagttc
agtcatgatgaaatggctaaaaaggatcttcctgcagtgataaacttcatcacaaagatg
actggccaggaacaaatcttttacgtgggccattctcagggaacaacaatagcattcatg
gctttctccacaatgcctgagctggccagcaaaatcaagatgttctttgcactggctcct
gttgccacagtggggatgaccaaaagcccgatgaccaaactgtcagtaattccagagttt
ctgatttgggatctctttggtcaaaaagacttttttcctcagaatgaactgatcaagttt
ttcgccactgagttctgcagcaggaagcctttgagtgtgttgtgtggaaacgtcttcttt
cttctctgcggttttgatgagaagaacctgaacatgagtagaacacctgtgtatacggca
cactgtccagcaggaacctccgtccagaacatgattcactgggctcaggctgtgaaatcc
agtaagctcatggcatacgattatggaagagctggaaatatggcacattataatcagtcg
acccctccactttacaacatccaggacatgatggtacccacagctgtgtggtctggtgga
caggacactctggcagatcccaaggatgtggctttgctgctaacacagatccctaaattg
gtgtataaacgcgacattaagcactgggagcacctggattttatctgggggatggacgcc
ccacaagagatgtatgagaaaatgatcgaaataatgagggagaatgtttga

DBGET integrated database retrieval system