KEGG   Danio rerio (zebrafish): 406746
Entry
406746            CDS       T01004                                 
Symbol
fpgs
Name
(RefSeq) folylpolyglutamate synthase, mitochondrial
  KO
K01930  folylpolyglutamate synthase [EC:6.3.2.17]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00790  Folate biosynthesis
dre01100  Metabolic pathways
dre01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    406746 (fpgs)
Enzymes [BR:dre01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.17  tetrahydrofolate synthase
     406746 (fpgs)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Other DBs
NCBI-GeneID: 406746
NCBI-ProteinID: NP_998602
ZFIN: ZDB-GENE-040426-2781
Ensembl: ENSDARG00000044809
UniProt: F1Q7N0
Position
21:6114710..6134490
AA seq 572 aa
MLLFRVLENLRAWTEVSARNRHWTSIVGLSVRFSSTKAAPRYRRMDYQDAVCTLNTLQTN
ASALEQVKRERGHPQLQLQAMRGFLQRAGLKVEELDRLNIIHVTGTKGKGSTCAFTEKIL
RNYGFRTGFYSSPHLVQVRERIRINGQPIGKELFTKYFWQVYGRLEETKDAHGGSMPAYF
RFLTILAFHVFLQEKVDLAVIEVGIGGAYDCTNIIRRPWVCGISSLGIDHTSILGDTIEK
IAWQKGGIFKPGVPAFTVKQPDGPMKVLQERAEEVGCSLSVCPDLDEYESEGSLSLGLAG
QHQRSNASLALQLSHTWLQRHILTDPASPVEFSGVSSAPAFQPSPAMIKGLAETEWPGRN
QTLKHGPVTYYMDGAHTTRSMQACVRWFNEVATQHERNAGGSVLRVLLFNATGERDCAAM
LKLLAPCHFDFAVFCPNITEAIASCNADQQNFNVSVENMLTRCLDNQQSWRVLNGHEEKP
EAELLIGGGLPLVAERHGDTLVFPCILSALQWISQGRDSVLADANKHTIPVKPSINAKAA
PLREAQNIHVLITGSLHLVGGALKHLDPALNS
NT seq 1719 nt   +upstreamnt  +downstreamnt
atgctgctgttccgcgtgctggagaatttacgcgcgtggactgaagtctcggcgcgtaac
cgacactggaccagcattgtcgggctgtcagtgagattttccagcactaaagctgctccg
cggtaccgaagaatggactatcaggatgcggtttgcaccctcaacaccctccagacgaat
gccagcgctctggagcaggtgaagcgagagcggggacatcctcagctccagctgcaggcc
atgaggggctttcttcagcgagcaggactcaaggtagaagaactggatcgtcttaatatt
attcatgtaactggaacaaaaggaaagggatcaacatgtgccttcacagaaaagattttg
agaaactatggcttccgcactggattctacagttctcctcatttggtgcaagtgagagag
cggatccgaatcaacggtcagccaataggaaaagagcttttcaccaaatacttctggcaa
gtgtatggacgactggaggagacaaaggatgcccatggtggcagcatgcctgcttatttc
cgctttctcactatcttggccttccacgtctttcttcaggagaaggttgatttggccgtt
attgaggtcgggattggtggagcgtacgactgcaccaacattatcaggcgtccttgggtg
tgcggtatctcgtctttaggtatcgatcacactagcattctgggagacaccattgagaaa
atcgcctggcagaaaggagggatttttaagcctggagttcctgcgttcacagtcaaacag
cctgacgggccgatgaaagtgcttcaggagagagcagaagaagttgggtgctcgctgtcg
gtgtgtccagatctggatgagtacgagagcgagggttccctcagcttggggttagctggt
cagcatcagcgcagcaacgcgtctttggctcttcagctctcacacacatggctgcagaga
cacatcctcacagatccagcgtctccagtggagttcagcggtgtgagttcagctccagcg
tttcagcccagtcctgcaatgatcaaaggtcttgcggagactgagtggcctggacgcaat
cagacactaaaacacggtcctgtgacctattacatggatggagctcataccacacgcagc
atgcaggcctgtgtgcgctggttcaatgaggtcgcaacacaacacgagaggaacgcagga
ggttcagtgctgagggttctcttattcaacgctacaggagagagagactgtgccgccatg
ctcaaactgctggcaccctgtcattttgactttgctgtgttttgtccaaacatcacagag
gccatcgcgtcctgtaatgcagaccaacagaacttcaacgtttctgtggagaacatgctg
acccgttgcctggataaccagcagagttggcgcgtcctaaatggacatgaggagaagccg
gaggcagagcttctgattggcggaggcctgccattggttgctgagcgtcacggggacacc
ctggtattcccctgcatcctcagcgccctgcagtggatcagtcagggtcgagactcagtc
ctggcagacgcaaacaaacacacaatacctgtcaagcctagcataaacgctaaagctgcg
ccgcttcgagaggcccagaacatacacgtcctcatcacaggcagcttacacttggtggga
ggagccttaaaacacttggatcccgctttaaactcttaa

DBGET integrated database retrieval system