KEGG   Danio rerio (zebrafish): 406768Help
Entry
406768            CDS       T01004                                 

Gene name
zgc:55262
Definition
(RefSeq) calpain 1, large subunit
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04141  Protein processing in endoplasmic reticulum
dre04210  Apoptosis
dre04217  Necroptosis
dre04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:dre00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    406768 (zgc:55262)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    406768 (zgc:55262)
   04217 Necroptosis
    406768 (zgc:55262)
   04218 Cellular senescence
    406768 (zgc:55262)
Enzymes [BR:dre01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     406768 (zgc:55262)
Peptidases [BR:dre01002]
 Cysteine Peptidases
  Family C2: calpain family
   406768 (zgc:55262)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 406768
NCBI-ProteinID: NP_998624
ZFIN: ZDB-GENE-040426-2814
Ensembl: ENSDARG00000045199
Vega: OTTDARG00000043504
UniProt: Q7ZUR1
Position
7
AA seq 704 aa AA seqDB search
MEPICATGMAARLRSQWDRDAGLGQNHNAVKFLGQDYETLRAQSQQSRRLFEDPMFTASS
SSLGFNELGPRSSKTQGVRWMRPKEMCARPQFIVDGATRTDICQGALGDCWLLAAIASLT
LNDNLLHRVVPHGQDFDSRYAGIFHFQFWQFGEWVDVVIDDRLPTKDGKLLFVHSAEGGE
FWSALLEKAYAKLNGCYEALSGGSTCEGFEDFTGGVTEMYELKKAPADLFSIIGRAIERG
SLLGCSIDITSKFDMEAVTFKKLVKGHAYSVTGAEEVVYRGNMTKLVRIRNPWGEVEWTG
AWSDNSREWDNVDRSVRGRLQNRSEDGEFWMSFSDFLREFTRLEICNLTADALQASQVKK
WSTANYNGEWRRGSTAGGCRNYPATFWNNPQFKVALKHPDSPGQSECSFLVALMQKDRRK
KRREGQDMETIGFAIYEVPREFLGQSGVHLKRDFFLTHASSARSELFINLREVSSRFRLP
AGEYIIVPSTFEPNKEADFVLRVFSEKPANSEEMDDKVMAEIPEEQRLDESQIDAGFKSL
FRQLAGADMEISVTELQTILNRIIAKHKDLKTDGFGKESCRSMINLVDTDGSGKLGLVEF
HVLWEKIKRYLQIFRDHDVDKSGTMSSYEMRKALETAGFKLNNHLFQLIILRYTEEDLSV
DFDNFVSCLVRLETMFKTFKSLDTDADGVISLTFFQWITLTMFA
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggagcccatctgcgccactggaatggctgcgaggctgcggagtcagtgggatcgagac
gcgggtttgggtcaaaaccacaacgctgtcaagttcttgggtcaagattacgagacgctg
agagctcagagccagcagagcagacgactgtttgaggatccaatgttcaccgccagcagc
tcttccctgggcttcaatgaactcggcccgcgatcctccaaaacacaaggagtgcgctgg
atgagacccaaggaaatgtgtgcgcgtcctcagtttatcgtggatggagccactcgcaca
gacatctgtcagggagcgctgggtgattgttggctgctggctgctatcgcgtccctgact
ctgaatgataatctgctgcatcgcgtggtgccgcacggacaggactttgacagcagatat
gcaggaatattccacttccagttctggcagtttggtgaatgggtggacgtggtgatcgac
gaccggctgccgacgaaggatggcaaactgttattcgtgcactcggcggagggtggagag
ttctggagtgctctgctggagaaggcctacgccaagctgaacggctgttacgaggctctg
tctggaggcagcacgtgtgaaggcttcgaggatttcaccggtggagtgacagagatgtac
gagttaaagaaagctcccgctgacctcttcagcattatcggccgcgccatcgagagaggc
tcgctgctgggctgctctattgatatcaccagtaagtttgacatggaggcggtgaccttt
aagaagctggtcaaaggccacgcatattctgtgaccggagcagaagaggtggtctacagg
gggaacatgaccaaactggtgcgcatcaggaacccgtggggggaagtggagtggactgga
gcctggagcgacaactctcgcgaatgggacaatgtggaccgctccgtcaggggccgacta
cagaaccgcagtgaggacggagagttctggatgtcgttcagtgattttctgcgcgagttc
acccgtttggaaatctgtaacctgacggcggacgctctccaggccagtcaggtgaagaag
tggagcaccgccaactataacggcgagtggaggagaggaagcaccgccggcggctgcagg
aactatccagcaacattctggaacaacccgcagttcaaggtggccctgaaacacccggat
tctcccggccaatcagagtgcagcttcctggtggcgctgatgcagaaggaccgcaggaag
aagaggagagaagggcaggacatggagactatcggattcgccatttatgaggtgccaaga
gagtttctgggtcagtctggtgttcatctgaagcgggatttcttcctcacacacgcatcc
agcgctcgatcggagctcttcattaacctgcgggaggtgagctcccgtttccggctgccc
gcgggcgagtacatcatcgtcccgtccaccttcgagccaaacaaagaggccgatttcgtg
ctcagagttttctcagagaagcccgccaactcagaagaaatggatgacaaagtcatggct
gaaattcctgaggagcaacgtcttgatgagagtcagattgacgctggttttaagagtctg
ttcagacagctggctggagcggacatggagatcagtgtgacggagctacagacgatcctg
aacagaatcatcgccaaacataaagatttaaagacagacggctttggtaaggagtcgtgt
cggagtatgatcaacctcgtggacacggatggcagtgggaaactcggactcgtagagttt
catgtgttgtgggagaagattaaacgctacctgcaaatcttccgcgatcacgatgtggat
aaatcaggcactatgagctcgtatgagatgaggaaagctctggaaactgcaggatttaag
ctgaacaatcatttattccagctgatcatcctgcgctacactgaggaggatctttccgtg
gattttgacaactttgtgtcctgtttagtgcgactggagaccatgttcaagacgttcaag
agtctggacacagacgctgatggagtcatttcactcacattcttccagtggatcaccctg
accatgtttgcctga

DBGET integrated database retrieval system