KEGG   Danio rerio (zebrafish): 406793
Entry
406793            CDS       T01004                                 

Gene name
med25
Definition
(RefSeq) mediator of RNA polymerase II transcription subunit 25
  KO
K15168  mediator of RNA polymerase II transcription subunit 25
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dre03021]
    406793 (med25)
Transcription machinery [BR:dre03021]
 Eukaryotic type
  RNA polymerase II system
   Mediator complex
    Other mediators
     406793 (med25)
SSDB
Motif
Pfam: Med25_VWA Med25 Med25_NR-box
Other DBs
NCBI-GeneID: 406793
NCBI-ProteinID: NP_999931
ZFIN: ZDB-GENE-040426-2850
Ensembl: ENSDARG00000038005
Vega: OTTDARG00000037466
UniProt: Q6PEH8
Position
3
AA seq 701 aa
MDPTSKSGLNQVSDVVFVIEGTANLGPYFESLRNNYILPTIEYFNGGPPAETDFGGDYGG
TQYGLVVFNTVDCAPESYVQCHAPTSSAFEFVSWIDSIQFMGGGAESCSLIAEGLSVALQ
LFDDFKKMREQIGQTHKVCVLLCNSPPYLLPAVESVSYTGCTADSLVQIIRDRGIHFSVI
APRKLPALRSLFERASSVAGLPESSHPDYSQDPFHMVLVRGIALPVAPGGGSVPVSLKPV
LPPQSLPVNQNPLVPVASTAPQMNTFQNVSLHAAHDAAQKALEEAANQQQKNRFGQISTP
PFSQSPVLPPGGKPSLSTVTTVSPPVLTQQQVPPQQPQQQTQVPQPGLPAVNQQPPQASQ
QQPNNQQTPPPTQPGMAAVPAPPPGAQQGVANKVVAWSGVLEWQEKPKASSMDSNTKLTR
SLPCQVQVSQGENLNTDQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFLFTNKDMESLKG
LFRIMTSGFAGCVHFPHSAPCEVRVLMLLYSSRKRIFMGLIPNDQSGFVNGIRQVITNHK
QVQQQRSMQPGQVQPNQNFLNRPPGPIPVTHGNVPQQLRAAATGNQQAPVTGAPPNQVQG
QAQAPGGGMLRLQNPGANPQLRSLLLSQQPQGGMQGMQGMHPIQQMVHAAPGGGAQMQPQ
WRQPHQGPLMVPTGPRGPVTQNPGMPSVSSVMEDEILMDLI
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggaccccacgtccaaatctgggttgaatcaggtgtcagatgtggtgtttgtcattgaa
ggaactgcaaaccttggtccatattttgaatcacttcggaataattacatactgcctact
atagagtattttaatggaggaccaccggctgaaactgattttggaggagattatggtggc
actcagtatggactggtggtattcaacacagtggattgtgctccagagtcatatgtccag
tgccatgctccaaccagctctgccttcgagtttgtgtcttggattgacagcattcagttc
atgggaggtggagcagagagctgcagtcttatagctgagggtctttctgtggccctgcag
ctctttgacgacttcaaaaagatgagggagcaaattggtcagacccacaaggtgtgtgta
ctgctctgtaattctcctccatacttgctgccagctgtggagagtgtcagctatacgggc
tgcaccgcagacagtctggtccagatcatccgggatcgggggattcatttttctgtaatt
gccccacggaaacttccggcacttcgatctctttttgaacgagcatcatcagtagcaggt
ctaccagagtcttcacacccagactacagtcaagacccctttcacatggtattagttagg
ggtattgcacttcctgttgctccaggaggaggttctgttcccgtctctctcaaacctgtc
ttgccacctcagtctctgccagtgaaccagaatcctctggtgcctgtagcttcgacagct
cctcaaatgaacacatttcagaatgtctctctacacgcggcacatgatgcagcacagaag
gcactagaagaagccgccaatcagcaacagaagaatagatttggtcaaatatcgactcct
cccttcagtcaatcaccggttctcccaccaggaggtaaacccagcctgtctacagttacc
acagtgtcaccgccagtgttgacgcagcagcaggttccacctcagcagccacagcagcag
acacaagtcccacaaccaggcctgcctgcagtaaaccaacagcctcctcaagcttctcag
cagcagcccaacaatcagcagacgccgccgccaacacagcctggcatggctgctgtacct
gcacctccgcctggggcacagcaaggtgttgccaacaaggttgtggcatggagtggagtt
ctagaatggcaggagaagcccaaggcctcctccatggactccaacacaaaacttacacgc
tccctgccctgccaggtccaagtcagccaaggagagaatctaaacacagaccagtggcca
cagaagctgatcatgcagctcatccctcaacagctcctgaccactctaggccctctgttc
aggaactctcgtatggtgcagtttctgttcactaacaaagatatggagtctttaaaagga
ctgtttcgtattatgaccagtggatttgctggatgtgtgcacttcccccacagtgctccg
tgtgaggtgcgtgtgctgatgctgctgtactcatctaggaagaggatcttcatgggactc
attcctaatgaccagagtggattcgtcaacggcattcggcaggtcatcactaaccataaa
caagtgcaacagcaacgctcgatgcaacctggacaggtgcagcccaatcagaacttcctc
aacagaccgccgggccccattcctgttacacatggcaacgtgccacagcagctgagagca
gccgcaacaggcaatcagcaggcgccggtcactggtgctccacccaatcaggtccaaggt
caagctcaggctcctggtggaggcatgctccgcctccagaacccaggcgcaaacccccag
ctccgcagtctgctcctcagccagcaacctcagggtggtatgcaaggcatgcaggggatg
catcctatccagcagatggtccatgcagcaccaggagggggcgctcagatgcagcctcag
tggagacagcctcaccagggtccactaatggtcccgacgggtccacgtggtccagtcaca
cagaatccagggatgccttcggtgtcgagcgtcatggaggatgaaattcttatggatcta
atctaa

DBGET integrated database retrieval system