KEGG   Danio rerio (zebrafish): 406815
Entry
406815            CDS       T01004                                 

Gene name
aebp2
Definition
(RefSeq) zinc finger protein AEBP2
  KO
K17452  zinc finger protein AEBP2
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:dre03000]
    406815 (aebp2)
   03036 Chromosome and associated proteins [BR:dre03036]
    406815 (aebp2)
Transcription factors [BR:dre03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    406815 (aebp2)
Chromosome and associated proteins [BR:dre03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb group proteins
    PRC2-EZH2 complex
     406815 (aebp2)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2
Other DBs
NCBI-GeneID: 406815
NCBI-ProteinID: NP_998659
ZFIN: ZDB-GENE-040426-2885
Ensembl: ENSDARG00000006038
Vega: OTTDARG00000012575
UniProt: Q7SXV2
Position
4
AA seq 415 aa
MASTTSDASEQESANPSEKNGDGSESGLRAADPEPAVKMDEADTDEKPGGHEPTEQSPEE
ATRDGGNDEDGETEKEQQKSPGSADGTAERMKREQREEESVSLPAEKNSGGGGTGMKRRA
SLEMMSSSSDGEPLSRMDSEDSINSTLMDTESIPSSGRSTPAMMNGLGGASSSTKGSSYP
CCWDQCHMLFNTSPDLAEHIRGVHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLSH
SGDKPFKCVVGGCNATFASQGGLARHVPTHFSSQNSSKLSSQTKVKEESPSKAGMNKRRK
LKYKRRRSLPRPHDFFDAQTMDAIRHRAICLNLATHIESQGKGHSVVFHSTVIARRKEDS
GKVKVLLHWTPEDILPDSWVSESDRPQLKTKVVHLSQLPQDTAFLLDPNIYRMFF
NT seq 1248 nt   +upstreamnt  +downstreamnt
atggcttcgacgacctccgacgcttccgagcaagagtcagcgaacccgagcgagaaaaac
ggcgacgggagcgagtcgggcctgcgcgccgccgatccggaaccggccgttaagatggac
gaagcggacacggacgagaagcccggtggacacgagcctacagaacaaagcccagaggaa
gccacgcgggacgggggtaatgatgaagacggggagaccgaaaaggagcagcagaagagc
cccggtagcgcggacgggacggcggagcggatgaagagagaacaaagggaggaggagagc
gtgtccttaccggcggagaaaaacagcggcggcggcggcaccggaatgaagcgccgcgcg
agcctggaaatgatgagctcgtcttcggacggagagcctctcagccgcatggactcggag
gacagtattaacagtactctcatggacacggagagcattccgtccagcggtcgctctacc
ccagctatgatgaatggtctcggtggggcgtcttcctccactaagggctcatcttacccc
tgctgctgggatcagtgccacatgctgttcaacaccagcccggacctggccgaacacatc
cgcggagtgcatgtggatggacagcgtggcggggtattcgtgtgtctttggaagggctgt
aaggtgtataacacaccatctaccagtcaaagctggctccagagacacatgctgtcacac
agcggagacaaaccattcaagtgtgtggtgggtggttgcaatgccaccttcgcctcccag
ggggggctagcgcgccatgtgccaacccactttagctcccagaattcctccaaactttca
agccaaaccaaggtgaaggaagaatctccttccaaagcgggcatgaacaaaaggaggaag
ctcaagtacaagcggcggcggtctttgccgcgaccgcatgacttttttgatgctcagact
atggatgcaatccgtcatcgcgccatctgcctcaatctagcaacccatattgagagccag
ggcaaaggccacagcgttgtgtttcacagtacggtgatcgccaggcggaaggaggattct
gggaaggtgaaggtgctgcttcactggacgccagaggacatacttccagattcctgggtc
agtgagagtgaccgtcctcagctgaagaccaaagttgtccacctttcacagcttcctcag
gacacagcgtttctgctggacccaaacatttacaggatgtttttctag

DBGET integrated database retrieval system