KEGG   Danio rerio (zebrafish): 407667Help
Entry
407667            CDS       T01004                                 

Gene name
asic4b
Definition
(RefSeq) acid-sensing ion channel 4-B
  KO
K04831  acid-sensing ion channel 4
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:dre04040]
    407667 (asic4b)
Ion channels [BR:dre04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   407667 (asic4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ASC
Motif
Other DBs
NCBI-GeneID: 407667
NCBI-ProteinID: NP_999951
ZFIN: ZDB-GENE-040513-6
Ensembl: ENSDARG00000004243
Vega: OTTDARG00000027214
UniProt: Q708S3
Position
6
AA seq 558 aa AA seqDB search
MPIEFVCKIKFAEGEEAKGASTEGGGTGMLDEGLRRQKEGMADLASFASSSSLHGLARAL
GTSERLGFRQTLWGLALLVSLGLFLYQATWSAATYLERPHLAALREETRRELTFPAITLC
NVNRFRFSALTDADIYHLANLTGLPPKSRKGHRPSELQYPPPNMLDIFQRTGHQLEDMLK
SCNFSGQNCSSEDFSVVYTRYGKCYTFNGNKTSPKRVRQGGTGNGLEMMLDIQQDEYLPI
WRETNETTLEAGIRVQIHSQNEPPYIHQLGFGVSPGFQTFVSCQEQRLTYLPQPWGNCRA
SSEPVIPGYDTYSVSACRLHCESTQVQRECNCRMVHMPGDADICAPSKIKCVDKALASLQ
KSTGDSCPCETPCNLTRYGKELSMVKIPSRGSARYLSRKYQKSEEYIRDNFLILDIFFEA
LNYETIEQKKAYDIAGLLGDIGGQMGLFIGASILTILEILDYIYEVAKNKIKQLLKPKKS
QKQTNQRNLIQEQIQRTKNLREQNLKAQLTAGAIATVRFEEVKVKAANDVAQPHSAHPTS
VLPNHHNAQQAVQQDFAC
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgaatttgtttgtaaaatcaagttcgctgagggcgaagaagccaagggggcc
tcgacagaaggaggaggaaccggcatgctagatgaaggccttcggcggcaaaaagaaggc
atggctgacctggcatcctttgcaagctcctcttcacttcacggtttggctcgggcacta
gggacctcggagcgcttgggtttcagacagactctttggggactggcactgctggtctcg
cttggtctcttcctgtaccaggcgacatggagtgcggcgacttatctggagcgtccccac
ctcgcagctctaagggaagaaacccgccgagagctcacctttccggccatcacgctctgt
aacgtcaacagattccgcttctctgccctcacagatgcggacatctaccacttggctaac
ctcaccggccttccgcccaagagccgtaaaggacaccggccaagcgagctccagtaccca
cccccaaacatgctagacattttccagaggactggccaccagctggaagacatgctgaag
agctgcaacttcagcgggcagaactgctcaagcgaagacttcagcgtggtttacacacgg
tatgggaaatgttacacatttaatggaaacaagacgtcacccaagcgtgtaaggcaaggt
ggcacaggaaacggcctggagatgatgctggatattcagcaggacgagtatctgcctatc
tggagagaaaccaacgagactacgctggaagcaggtattcgggttcagatacacagtcag
aatgaacccccgtacatccaccagctgggctttggagtctcaccaggattccaaacattt
gtttcctgccaggaacagaggctaacatacctgccacagccgtggggaaactgtcgggct
tcatccgagcctgtgatcccaggatacgacacctacagcgtcagcgcctgcagactgcac
tgtgagagcacacaggtgcagagagagtgcaactgcaggatggtgcatatgccaggtgat
gctgatatctgtgcacccagtaaaatcaagtgtgttgacaaggctttggcttcactccag
aagagcacaggtgactcatgtccctgcgagacaccctgtaatttgacccggtatgggaaa
gagctctctatggttaaaatccccagcagaggctctgctcgctacctttctcgcaagtac
cagaagtcagaggagtacatcagagacaactttctcatcttggatattttctttgaggcc
cttaactatgaaacgattgagcagaagaaagcgtacgacatcgctggtttgttaggagac
attggtggacagatgggcctcttcattggagccagtattcttaccatactggaaatactc
gactacatctatgaggtagccaaaaacaaaatcaagcaactcctgaaaccaaagaagagc
cagaaacaaaccaaccaacggaacttgatccaagagcagatccagagaaccaagaacctg
cgggagcagaacctgaaagctcagctaactgccggagcaatagctacagtcaggtttgaa
gaagtcaaagtcaaggcagctaatgatgtggctcaaccacacagcgcacatccaacttcg
gtattaccaaatcatcacaatgcacaacaagccgtacagcaggactttgcttgttaa

DBGET integrated database retrieval system