KEGG   Danio rerio (zebrafish): 431715
Entry
431715            CDS       T01004                                 

Gene name
rbck1
Definition
(RefSeq) ranBP-type and C3HC4-type zinc finger-containing protein 1
  KO
K10630  RanBP-type and C3HC4-type zinc finger-containing protein 1 [EC:2.3.2.31]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04217  Necroptosis
dre04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    431715 (rbck1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    431715 (rbck1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    431715 (rbck1)
Enzymes [BR:dre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     431715 (rbck1)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    431715 (rbck1)
  Multi subunit Ring-finger type E3
   LUBAC complex
    431715 (rbck1)
SSDB
Motif
Pfam: IBR zf-RanBP ubiquitin zf-RING_5 zf-RING_UBOX zf-C3HC4 zf-RING_11 zf-RING_2
Other DBs
NCBI-GeneID: 431715
NCBI-ProteinID: NP_001002168
ZFIN: ZDB-GENE-040704-3
Ensembl: ENSDARG00000031954
Vega: OTTDARG00000009161
UniProt: Q6GMF9
Position
22
AA seq 515 aa
MAALDASRNVTEAEDAARLLSDAINSRDKDEATKYLNQLLDLKLPVSVKINPDAYSQDNI
RLRVGVADAESEHHIPITVMVPVYMTISELKEKINGDYGFHPSLQRWVIGKRLAQDKETL
YFYGIRNHDDSAFLFIRSAQSVNLRREQERREKEERQIDVIMETIERPLQRPPERITRGN
TRPALPPKPKFLDGWACPQCTYLNKPTRPGCEMCSTARPDNYQVPDLYQPDESETRRLQQ
EELASLQYEQSLLQEEERNFLERQRNYEELLQTDAHSLVGNTDQLECAICFGTIMPGEGA
VLRECLHSFCRDCLKGTVVNCLDAEVCCPYGDNAYACNCKLQDREIKSLLTQDEYQKFLE
LRLNIAESRSENSYHCKTPDCAGWCIFEDDVNEFKCDICNETNCLLCKAIHKGMNCKEYQ
DDLRVRAQNDEAARQTTEMLDQLLKNGEAMNCPKCQVIVQKKDGCDWICCLMCKTEICWV
TKQARWGPLGAGDTSGGCKCRVNGVLCHPQCQNCH
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggctgctcttgatgcctctagaaatgtaacggaagcggaggatgccgctcgacttctt
agtgacgccatcaactccagagacaaagatgaagcaactaaatacctgaatcaacttctg
gatctgaaactcccagtgagcgtcaaaattaatccagatgcatattctcaagacaacatc
agattaagagttggagtggctgatgctgaatcagaacatcacatcccaataacagtgatg
gtaccagtttacatgacaatatccgagctgaaggaaaagatcaacggtgactatggcttc
catccgtctctccagcgctgggtgatcgggaagcgtctcgcccaggacaaagaaaccctt
tatttttatgggatccgaaaccacgatgattctgccttcctcttcatccgctctgctcag
tctgtcaatctgcgccgcgaacaagagagaagagagaaagaggagaggcagatcgatgtt
ataatggagaccattgaacgtcctcttcaacgtccaccagagcgcatcactagaggaaac
actcgccctgctctacctccaaaacccaaatttctggatggttgggcatgtcctcagtgc
acgtacctgaataaaccgacacgtccaggttgtgagatgtgcagcacggcgagacccgac
aactatcaggtgccggacttgtaccagccggacgagtctgaaaccaggagactacagcag
gaggaactcgccagcctgcagtatgagcagtctctgttacaagaggaagaaagaaatttc
cttgaacggcagaggaattacgaagaactcctgcaaacagatgcacacagcctggtggga
aacacagatcagctggagtgcgccatttgttttggcaccatcatgccaggagagggcgcc
gttttaagagagtgccttcatagcttctgcagggactgtctgaaagggaccgtagtgaac
tgcctggacgctgaggtttgttgtccttatggagacaacgcttatgcctgtaactgcaaa
ctccaagatcgagagatcaaatctcttctcactcaggacgagtaccaaaaattcctagaa
ctgcggctgaatatcgctgagtcccgcagtgagaacagttaccattgcaaaaccccggac
tgcgctggctggtgcatcttcgaagatgacgttaacgaatttaagtgcgacatctgcaat
gagaccaactgcctcctctgcaaggctattcataaaggaatgaactgcaaggagtaccag
gacgacctacgtgtgagagcgcagaacgatgaagcggctcggcagaccacagagatgctg
gatcaactgctaaagaatggcgaggcgatgaactgtcccaaatgtcaggtgatcgtccag
aagaaagacggctgtgactggatctgttgtctaatgtgcaaaaccgagatctgctgggtg
accaaacaagcccgatggggacctttgggtgctggagacacatcaggcggatgcaaatgt
cgagtaaacggagtcctttgtcatccgcaatgccagaactgccactaa

DBGET integrated database retrieval system