KEGG   Danio rerio (zebrafish): 431756
Entry
431756            CDS       T01004                                 

Gene name
rabepk
Definition
(RefSeq) rab9 effector protein with kelch motifs
  KO
K20285  Rab9 effector protein with kelch motifs
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    431756 (rabepk)
Membrane trafficking [BR:dre04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    431756 (rabepk)
SSDB
Motif
Pfam: Kelch_4 Kelch_5 Kelch_2 Kelch_3 Kelch_6 Kelch_1
Other DBs
NCBI-GeneID: 431756
NCBI-ProteinID: NP_001002209
ZFIN: ZDB-GENE-040704-52
Ensembl: ENSDARG00000112165
UniProt: Q6GQN7 B2GNL1
Position
5
AA seq 351 aa
MELIPVLEPEQKPQNRHWYVLEPTGAAPGVSVGHTCSFLPAAHHHDEDGGGKGKIVIVGG
ANPSGSFADSYIINLDTHQWDLPDWEGLQARYEHCSFTPESEPQSLWVFGGAEKSTNRNC
VQALRFSDGGEGRRFWQSVQVTGVPPSGRTYHTNSACVGNRLFVFSGGEAGSSAVTDAQL
HVFDAVSVTWTQPDTTGTPPAQRHGHVITAVGSDIYIHGGMSGEKFHSDMFTLNTESLKW
QKVKAKGDLPPGVAAHSSVTFNKNIFIFGGMTADGATNSMFKFQCDKQRWTLLKFEGDLP
PGRLDHSMCLLPWRVKMEDSEHADVQHLCFVFGGMDTQGVIFNDCLVTVLT
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggagctgattcctgttctggagcccgagcagaagccgcagaacagacactggtatgtt
ctggagcccacaggtgcagctcctggagtctccgtaggccacacctgctcattcctgccc
gctgcccatcaccatgatgaagatggaggaggaaaggggaagattgtgattgtcggagga
gcaaatcccagtggaagcttcgctgactcctacatcatcaatctagatactcatcaatgg
gatcttccagattgggagggtctgcaggcacgttatgaacactgcagtttcactcctgaa
agcgagccgcaaagcctctgggtgtttggaggagcagagaagagcacaaaccgcaactgt
gttcaagcgctgcgcttctcagatggtggtgaaggccgcaggttttggcagtcggtgcag
gtgactggagtgcctccttctggccgcacgtatcacacaaactcagcttgtgttggaaac
cggctgtttgtgttttctggaggagaagcaggatcttcagcagtcactgatgcgcagctc
cacgtgtttgacgcagtcagtgtgacgtggacgcagccggacaccacagggactcctcca
gctcagagacacggacatgtgatcacagccgtgggttcagacatttacatacacggagga
atgagcggagagaagtttcacagcgacatgttcacactgaacacagagtctctgaaatgg
cagaaggtgaaggctaaaggtgatctcccacccggagtcgcagctcattcatctgtaaca
ttcaacaaaaacatcttcatctttggaggaatgacggcagacggagccacaaactccatg
tttaagtttcaatgcgataaacagcgctggactctgctgaagtttgagggggatcttcct
ccgggtcggctggatcactccatgtgtttactgccgtggagagtaaagatggaggacagc
gaacatgcagacgttcagcatctgtgctttgtctttggaggaatggacactcagggcgtc
atattcaacgactgccttgttactgtgctgacgtga

DBGET integrated database retrieval system