KEGG   Danio rerio (zebrafish): 436601
Entry
436601            CDS       T01004                                 

Gene name
kctd6b
Definition
(RefSeq) BTB/POZ domain-containing protein KCTD6
  KO
K21916  BTB/POZ domain-containing protein KCTD6
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dre04121]
    436601 (kctd6b)
Ubiquitin system [BR:dre04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     436601 (kctd6b)
SSDB
Motif
Pfam: BTB_2 BTB_3
Other DBs
NCBI-GeneID: 436601
NCBI-ProteinID: NP_001002329
ZFIN: ZDB-GENE-040718-14
Ensembl: ENSDARG00000023703
Vega: OTTDARG00000028133
UniProt: Q6DG99
Position
23
AA seq 237 aa
MDNGDWGHRLTHPVTLNVGGHLYTTSISTLQRYPDSMLGAMFRGDFPTTRDAQGNYFIDR
DGTLFRYILNFLRTSELTLPVDFTELDLLRKEADFYQIEPLIQCLNDPKPLYPLDTFEQV
VELSSTRKLSKYSNPVAVIITQLTITTKVHSLLEGISNNFTKWNKHMMDTRDCQVSFTFG
PCDYHQEVSLRVHLMDYITKQGFTIRNTRVHHMSERANENTVEHHWTFCRLAYKVED
NT seq 714 nt   +upstreamnt  +downstreamnt
atggataatggggactggggacataggttgactcacccagtcaccttaaatgttggagga
cacctctacaccacctccatttccactcttcagcgttacccagactccatgctgggtgcc
atgtttcgtggtgacttccccactacacgggacgctcagggaaactatttcattgatcgg
gatgggacgcttttccgctatatattgaacttcctgcgcacatccgagctcactcttcct
gtagacttcactgagctggaccttctgcgaaaagaagcagacttctatcagatcgagcct
ttaatccaatgcctcaatgacccgaaacctctgtacccgctggacaccttcgagcaggtg
gtggagttgtccagcacacgcaagctgtccaagtactcaaatcccgtagcggtcatcatc
acacagctaaccataaccaccaaagtccactcgctgcttgaaggaatatccaacaacttc
accaaatggaacaagcacatgatggacaccagagactgtcaggtgtccttcacctttgga
ccgtgtgactatcaccaagaggtgtctctgcgggtgcacctcatggactacatcaccaaa
cagggcttcaccatcaggaacacacgggtgcaccacatgagcgaacgggccaatgagaac
actgtggagcatcactggactttctgcaggctggcgtataaagtagaagattga

DBGET integrated database retrieval system