KEGG   Danio rerio (zebrafish): 436733
Entry
436733            CDS       T01004                                 

Gene name
zgc:92907
Definition
(RefSeq) uncharacterized protein LOC436733
  KO
K07432  beta-1,4-N-acetylglucosaminyltransferase [EC:2.4.1.141]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00510  N-Glycan biosynthesis
dre00513  Various types of N-glycan biosynthesis
dre01100  Metabolic pathways
Module
dre_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    436733 (zgc:92907)
   00513 Various types of N-glycan biosynthesis
    436733 (zgc:92907)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dre01003]
    436733 (zgc:92907)
Enzymes [BR:dre01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.141  N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase
     436733 (zgc:92907)
Glycosyltransferases [BR:dre01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   436733 (zgc:92907)
SSDB
Motif
Pfam: Glyco_tran_28_C
Other DBs
NCBI-GeneID: 436733
NCBI-ProteinID: NP_001002460
ZFIN: ZDB-GENE-040718-161
Ensembl: ENSDARG00000011026
Vega: OTTDARG00000022621
UniProt: F1R0S3
Position
14
AA seq 164 aa
MKTVFVTVGTTSFDDLIDTVTSDESVKALIQRGFTGVNLQVGRGSVVPDPESCPGLKLQV
FRFKDSIAEDMRHSDLVISHAGAGSCLEALGANKPLLVVVNDKLMDNHQLELARQLQADS
HLIYCTCSTLPQTLREMDLTTLRPFAPGEPQNFAKFLDKAVGLV
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaaaaccgtttttgtgaccgtagggacaacaagttttgatgacctgatagacaccgtg
acttccgatgaatccgtgaaggcattaattcagcgcgggttcacaggcgtgaatcttcag
gttggcagaggttcagttgttcctgatccagaaagctgtccaggacttaaacttcaagtg
tttcggttcaaagactcaatcgccgaggacatgagacactcagacctggtcatcagtcac
gccggagcaggaagctgtttggaagcactcggagcaaataaacctctcctcgtggtggtc
aatgataaattaatggacaatcatcagctggagcttgcaaggcaactgcaggccgattca
catctcatctactgcacgtgcagtaccctgcctcagacgttgagggaaatggatctgaca
actttgagaccttttgcgcctggtgaaccgcagaactttgccaagtttttagataaagcc
gtcggacttgtttga

DBGET integrated database retrieval system