KEGG   Danio rerio (zebrafish): 436754
Entry
436754            CDS       T01004                                 

Gene name
gstz1
Definition
(RefSeq) maleylacetoacetate isomerase isoform 2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
dre  Danio rerio (zebrafish)
Pathway
dre00350  Tyrosine metabolism
dre01100  Metabolic pathways
Module
dre_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:dre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    436754 (gstz1)
Enzymes [BR:dre01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     436754 (gstz1)
SSDB
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2
Other DBs
NCBI-GeneID: 436754
NCBI-ProteinID: NP_001002481
ZFIN: ZDB-GENE-040718-184
Ensembl: ENSDARG00000027984
Vega: OTTDARG00000038881
UniProt: Q6DGL3
Position
17
AA seq 220 aa
MSATVARLIKPVLYGYYRSSCSWRVRIAFALKGIEYEQKPINLIKDGGQQLTDQFKAINP
MQQVPAVSIDGITLSQSLAIIQYIEETRPEPRLLPADPMQRAHVRIICDIIASGIQPLQN
LYVLQKIGEDKVQWAQHFINRGFQALEPVLKETAGKYCVGDEISMADICLVPQVYNADRF
KVDMTQYPTIRRLNQTLVEIEAFKASHPSRQPDTPDDLRL
NT seq 663 nt   +upstreamnt  +downstreamnt
atgagtgcaacagttgcacgtttaatcaagcctgtactttatggatattacagaagttct
tgctcctggagagtccggatagcatttgcattgaaaggcattgaatatgagcaaaagccg
ataaatctcatcaaggatggagggcagcagctcacggatcagtttaaggcaataaaccca
atgcagcaagtgccagcagtgtccattgacggcatcaccttgtctcagtctttggccatc
atccagtacattgaggaaacccgtccagagccccgcctcctgcctgcagaccccatgcag
agagctcatgtccgcatcatctgcgacatcatcgcctctgggatccagcctcttcaaaat
ctgtatgtgcttcagaaaatcggagaagataaggttcagtgggctcaacatttcatcaac
cgaggattccaggccctggagcctgtcctgaaggagacagcaggaaaatactgcgtgggt
gatgagatctctatggcagatatttgcctcgtgcctcaagtctacaatgctgacaggttc
aaggtggatatgacccagtatcccacgatcagaaggttaaatcagaccttggttgagatc
gaagccttcaaggccagtcacccttcacgtcagcctgatactccagatgatctgcggctg
taa

DBGET integrated database retrieval system