KEGG   Danio rerio (zebrafish): 436839
Entry
436839            CDS       T01004                                 

Gene name
rab10
Definition
(RefSeq) ras-related protein Rab-10
  KO
K07903  Ras-related protein Rab-10
Organism
dre  Danio rerio (zebrafish)
Pathway
dre04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dre00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    436839 (rab10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    436839 (rab10)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dre04147]
    436839 (rab10)
   04031 GTP-binding proteins [BR:dre04031]
    436839 (rab10)
Membrane trafficking [BR:dre04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    436839 (rab10)
 Protein recycling
  Rab GTPases and associated proteins
    436839 (rab10)
Exosome [BR:dre04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   436839 (rab10)
  Exosomal proteins of other body fluids (saliva and urine)
   436839 (rab10)
  Exosomal proteins of colorectal cancer cells
   436839 (rab10)
  Exosomal proteins of bladder cancer cells
   436839 (rab10)
GTP-binding proteins [BR:dre04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    436839 (rab10)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 AAA_7 DUF3963 Efg1
Other DBs
NCBI-GeneID: 436839
NCBI-ProteinID: NP_001002566
ZFIN: ZDB-GENE-040718-304
Ensembl: ENSDARG00000046106
UniProt: Q6DGV5
Position
20
AA seq 201 aa
MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKL
QIWDTAGQERFHTITTSYYRGAMGIMLVYDITNAKSFENISKWLRNIDEHANEDVERMLL
GNKCDMEDKRVVPKAKGEQIAKEHGIRFFETSAKANINIEKAFLTLAEDILKKTPVKEPN
SENVDISTGGGVTGWKTKCCS
NT seq 606 nt   +upstreamnt  +downstreamnt
atggcgaagaagacctatgatctgctctttaaactgctcttgattggcgattctggggtg
ggaaagacctgcgtgctgttccgattctccgatgacgccttcaacaccacctttatctcc
actataggaatcgattttaagatcaaaacagttgaattgcaaggaaagaagataaagcta
cagatatgggatacagcggggcaggaacggtttcacaccatcactacctcttactacaga
ggggcaatgggaatcatgctcgtatatgacatcaccaatgcaaagagcttcgaaaacatc
agcaaatggctcagaaacattgatgagcacgctaatgaggatgtggagaggatgctgcta
ggcaacaagtgtgacatggaggacaaacgtgtcgtaccaaaagccaagggggaacagatc
gcaaaagaacacgggattcgcttcttcgagacgagtgcaaaagccaacatcaacatcgag
aaggcgttcctcacgttagcagaagacattctcaaaaagacacccgtaaaagagcctaac
agtgaaaacgtggacatcagcactggaggaggagtcacaggctggaagaccaagtgctgc
agttga

DBGET integrated database retrieval system