KEGG   Danio rerio (zebrafish): 436881
Entry
436881            CDS       T01004                                 

Gene name
rgp1
Definition
(RefSeq) RAB6A-GEF complex partner protein 2
  KO
K20477  RAB6A-GEF complex partner protein 2
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dre04131]
    436881 (rgp1)
Membrane trafficking [BR:dre04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    436881 (rgp1)
SSDB
Motif
Pfam: Rgp1
Other DBs
NCBI-GeneID: 436881
NCBI-ProteinID: NP_001002608
ZFIN: ZDB-GENE-040718-352
Ensembl: ENSDARG00000006545
Vega: OTTDARG00000020100
UniProt: Q6DHI8
Position
7
AA seq 386 aa
MIEVVASMARGPVFLAGEVLECLVTFTNPMSHLSTSASSEMLAWSSAQIHCQFHASESRV
ALPTQGTKQDVQAESDTVLIPSRGERGQCVLDTPPKILFCDLRLDPGESKTYSYSEVVPT
DGPPSFRGQAVKYVYKLTIGCQRVNSPIKLLRVPFRVLVLHGMPEPPFHQDEEVAPSNPF
LEEEEGSRRDTRPLERALDMLMITTSRRCPYMFNITNVRGKVAKFCIFKTVYRLGEDVIG
TFTFSEGDIPCIQYSVSLQSEEEVQEQYQRRPGQAVSVTGHGRHLESCLHTASSHFSLPV
PLNVTPGFTTDIVTLRWRLHFEFVTAREPVEAPVVLQNQSEVTVWTGAEHVDVDTFSWDL
PIKVLPTNPTLASYVSQFTGTNSINI
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgattgaggtggtggcatctatggcacgggggcctgtgtttttggccggagaggtttta
gaatgtcttgttaccttcacaaacccaatgtcacacctctctacatctgccagcagtgag
atgttggcatggtccagtgctcagatccactgccagtttcatgccagcgagagccgcgtg
gctctacccactcagggcaccaagcaggacgtgcaagctgagagtgacaccgtgctgata
ccaagcagaggtgaacgagggcagtgtgtcctggacacaccaccaaagattttattctgt
gatcttcgcttggaccctggagagagcaagacatattcctacagcgaggtcgtgcccact
gacggtccgcctagttttcggggtcaggcagtgaaatacgtgtacaaactcacgattggg
tgtcagcgagtcaactcgcctatcaaattactgcgagtccctttcagagtcctagtgctt
catggcatgccagagcctccgttccatcaggatgaagaagtagctccttcaaaccctttc
cttgaggaggaggaaggaagcaggagagatacaagaccactagaaagagcactggacatg
ctaatgatcactacctcacgccggtgcccatatatgttcaacatcacaaacgtgcggggg
aaggtggctaagttctgcatctttaagaccgtgtacaggcttggagaagatgttatcggc
actttcacattctcagaaggagatattccatgtatacagtattcagtaagtctgcaaagt
gaagaggaggtgcaggagcagtatcagagacgacccggccaggcagtcagtgtcactggt
catggccgacatctagagtcctgcttgcacacagcatccagccatttctctcttcctgtg
cctcttaacgtcacaccagggttcaccacagatatagtgacgttaagatggcgtctgcat
tttgagtttgtcacggcgagggagcctgtggaggcaccagtggtcctgcagaatcagtca
gaggtcacagtgtggaccggggccgagcacgtggatgtggacaccttcagctgggacctg
ccaatcaaagtgcttcccaccaatcccacgctcgcttcatatgtttcacagttcacaggg
acaaacagcatcaatatttga

DBGET integrated database retrieval system