KEGG   Danio rerio (zebrafish): 436931
Entry
436931            CDS       T01004                                 
Symbol
frs2b
Name
(RefSeq) fibroblast growth factor receptor substrate 2b
  KO
K12461  fibroblast growth factor receptor substrate 2
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:dre04990]
    436931 (frs2b)
Domain-containing proteins not elsewhere classified [BR:dre04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   436931 (frs2b)
SSDB
Motif
Pfam: IRS
Other DBs
NCBI-GeneID: 436931
NCBI-ProteinID: NP_001002658
ZFIN: ZDB-GENE-040718-406
Ensembl: ENSDARG00000037353
UniProt: Q6DG07 F1Q5H9
Position
25:complement(34727928..34740649)
AA seq 508 aa
MNQEPWWLDLGIKWSEEAMGSCFSCPDKESIPDNHQSKFKVVNVDDDGNELGAGIMELTE
DELVLRTRKCDAVKWPYLCLRRYGYDSNLFSFESGRRCQTGQGIFAFKCSRAEEIFNMLQ
DIMHNNSISVVEEPVFEPTLTQAEPDLPLTPHTPTTPGSMLPALPNGSLRYPSLGDAPSH
PSSRHPSVGSSCLPSLGEESTHPLLAAEEAVRGHTYVNTSGLLDQHSPSISDAPAELNAS
SPDGEEPVPQEAPDPGPRVQIEPEGVRFILGPTPVQRQRQKEATQSTGDEEATNGSIVSQ
PKNTDTAEITKLDEPSPEVSALSRRRSRPPPLTPDANANNSAQRRTALLDYENLPALPPL
REHPKGGSEDEDQPINGFHNHRQYSPDPTHYYINTENVTAPLSANKVESARWRDRSTPTF
FNFDFRRPCLESHKLNYIEVETETENSSNPQTPKTPTSPLPQTPTRRTELYAVIDVERTA
AMSSLQKALPRYDGTSRKTRHNSVDLPM
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgaaccaggaaccctggtggctggatctgggaatcaaatggtctgaagaagccatggga
agctgttttagctgtccagataaagaatcaatccctgacaatcaccagagcaaatttaag
gtggtgaatgtggatgatgatgggaatgagctgggggcaggaatcatggagctgacggag
gacgagctggtccttcgcacacgcaaatgtgatgctgtcaagtggccttacctgtgtctg
cgacgctacggctacgactccaatctcttctcgtttgagagcggccgtcgctgccagacc
ggtcaagggatatttgccttcaagtgttcacgagctgaagagatcttcaacatgctgcag
gacatcatgcataacaacagcatcagcgtggtggaggagccggtgttcgagcccacgctc
actcaagctgaaccagatcttcccctcactccacacacaccaaccactcctggcagcatg
ctccctgctctcccgaacggcagcttacggtacccatctctgggcgacgctccctctcac
ccctccagccggcatccgtctgtcgggagctcgtgtctgccttcactgggcgaggagtcc
acacaccctctgttagctgcagaggaggctgtacggggtcacacatacgtgaacaccagc
ggtctgctggatcagcacagccccagtatttcagatgctccggcagaactgaacgcctcc
tcgcccgacggagaggaacccgtccctcaggaggctccggacccgggccctcgagtgcag
atagagccagaaggtgtgcgcttcatcctgggcccgacgccagtgcagagacagcggcaa
aaagaagcaacccagagcacaggagatgaagaagcaacaaacggcagcatcgtttcacag
cctaaaaacacagacaccgccgaaatcactaaactcgacgaaccctctcctgaagtctcc
gcactctcccgccgtcgctcgcgccctccgcctctcactccagatgctaatgctaataac
tctgctcagcggagaaccgctttgctagactatgaaaatctccccgctctcccgccatta
agggaacacccgaaaggcggctccgaggatgaggatcagccaataaatggcttccacaac
caccggcagtacagtcccgaccctactcactactacatcaacaccgaaaacgtcactgcg
ccgcttagcgctaataaagtggagtcggcccgctggcgggaccgatccacgccaacgttt
ttcaacttcgacttccgccggccatgcctggagtcacacaaactgaactacatcgaggtg
gagaccgaaacggagaactccagcaaccctcagaccccaaaaacgcccacttctccactg
ccgcagacgcccacccgccggacggagctttacgcggtcatcgacgtggagcgaacggct
gccatgtccagcctgcagaaagcactgccccgttacgacggcacctccagaaaaacgcgc
cacaacagtgttgatctgcccatgtga

DBGET integrated database retrieval system