KEGG   Danio rerio (zebrafish): 436948
Entry
436948            CDS       T01004                                 

Gene name
ccr10
Definition
(RefSeq) C-C chemokine receptor type 10
Organism
dre  Danio rerio (zebrafish)
SSDB
Motif
Pfam: 7tm_1 DUF1772
Other DBs
NCBI-GeneID: 436948
NCBI-ProteinID: NP_001002675
ZFIN: ZDB-GENE-040718-424
Ensembl: ENSDARG00000040643
Vega: OTTDARG00000032043
UniProt: Q6DG12
Position
24
AA seq 412 aa
MGSFDLTTEDYSLNYDDDDDYNFTTDPSAFFGKELCEASPEQERNITIVQTTAFLVVFVL
GVIGNGLVIATFALYRRLRLRCMTDVFLFFLALSDMLLLLTLPLQTVETLIGSWEFGEPM
CKLNRGMYAINTYSGLLLLACISIDRYLVVVCTRSMRKRSSGTLFYSVLSALSIAVISIM
FSLPDLSFSSVDNVLNSNLSSCDMKVSEVKWKLWAQIAKIAGFCIPCITMIVCYGAIGHV
LIHTGGKGWRRQRTLWLMALLVVLFLLFQLPYTVVLLIKISTPTPTLCSDWTTLHIMEIV
TRNLAYVRCCLNPLLYALVGVRFRNDIIRLLTDAGCVCKCVSQKAPHLGNGSSITPSSPA
PTTLTHIPSTYQPGKNTSAPDTPAANTAQTFFFPTPVSGKVTSVISWCHQII
NT seq 1239 nt   +upstreamnt  +downstreamnt
atggggagctttgatcttaccacagaagattatagtctaaattacgacgatgatgatgat
tacaacttcactacagatccatccgccttctttggtaaagagctctgcgaggccagtcca
gagcaggagcgcaacattaccatagtccagaccacagccttcctggtggtcttcgtctta
ggcgtgattggaaacggcctggtcattgccaccttcgctctgtaccgccgtctccgtctg
cgctgtatgaccgatgtcttcctcttcttcctggctctgtccgacatgctgcttctgctg
acgctcccactgcaaacagtagaaactctgatcggcagctgggagttcggagagcccatg
tgcaaactaaaccgtggcatgtacgcaatcaacacctacagcggccttctgttattagcg
tgcattagcatcgatcgctatttagtagtggtgtgcactcgatctatgaggaagaggagc
tctggtacgctgttctacagtgtgctctctgcacttagcattgctgtaatctcaatcatg
ttcagtcttccagatctgagcttcagttctgtggacaacgtcttgaattcaaacctgagc
tcatgtgatatgaaagtcagcgaagtcaagtggaaactgtgggcccaaattgcgaagatc
gcaggattctgcatcccatgcatcacgatgatcgtgtgttacggtgcaatcggacacgtt
ctgatacacactggaggaaaaggctggcgtagacagagaactttatggttgatggcactt
ttggtggtgctctttctgcttttccagctgccctacactgtagtgttactgattaaaata
tccacaccaacaccaacactctgcagtgattggaccacgctgcacatcatggaaatcgtg
acccgaaatctggcctacgtgaggtgctgcttgaaccctctgctttatgcgctggttggc
gttcgcttcaggaatgacattatacggttgttgacggatgctgggtgtgtgtgtaagtgc
gtgtctcaaaaagcgcctcatcttggcaatggaagctccattactccgtcttctccagct
ccgactacacttacacacattccctctacctatcagcctggcaagaacacgtctgcacca
gatacacctgctgcgaacacagcgcaaacgttcttcttccccacaccggtgtctgggaaa
gttacttcagttataagctggtgtcatcagatcatctaa

DBGET integrated database retrieval system