KEGG   Danio rerio (zebrafish): 436975Help
Entry
436975            CDS       T01004                                 

Gene name
crebl2
Definition
(RefSeq) cAMP-responsive element-binding protein-like 2
Organism
dre  Danio rerio (zebrafish)
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1 CEP209_CC5
Motif
Other DBs
NCBI-GeneID: 436975
NCBI-ProteinID: NP_001002702
ZFIN: ZDB-GENE-040718-456
Ensembl: ENSDARG00000104049
Vega: OTTDARG00000037768
UniProt: Q642H2
Position
4
AA seq 119 aa AA seqDB search
MDDSKIVAGKVKKPGKRGRKPAKIDLKAKLERSRQSARECRARKKLRYQYLEELVSSKER
AICALREELDMYKQWCLAMDQGKIPSEIKALLTGDEQKTPQSCSNKTTKNSKYSSSSGI
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggatgacagtaagatagtggctggtaaagtgaagaaaccgggcaaacgcggccgcaaa
cctgccaagatcgacctgaaggccaagctggagcgcagcaggcagagcgcccgagagtgc
cgagcccgcaagaagctgcgataccagtacctggaggagctggtgtccagtaaagagaga
gccatctgtgccctgagggaggagctggacatgtataagcagtggtgtctggccatggat
caggggaagattccttcagaaatcaaggctcttctgacgggagacgagcagaagacgcct
cagagctgcagcaacaagacgaccaagaacagcaaatacagctccagcagcggcatctag

DBGET integrated database retrieval system