KEGG   Danio rerio (zebrafish): 436986
Entry
436986            CDS       T01004                                 
Symbol
mfsd5
Name
(RefSeq) molybdate-anion transporter precursor
  KO
K24175  MFS transporter, MFS domain-containing protein family, molybdate-anion transporter
Organism
dre  Danio rerio (zebrafish)
Brite
KEGG Orthology (KO) [BR:dre00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dre02000]
    436986 (mfsd5)
Transporters [BR:dre02000]
 Major facilitator superfamily (MFS)
  Metal transporters
   MFS domain-containing protein family [TC:2.A.1.40]
    436986 (mfsd5)
SSDB
Motif
Pfam: MFS_5 MFS_1 Sugar_tr
Other DBs
NCBI-GeneID: 436986
NCBI-ProteinID: NP_001002713
ZFIN: ZDB-GENE-040718-468
Ensembl: ENSDARG00000015997
UniProt: Q6DG19 A0A8M9PKP8
Position
23:complement(35786942..35790243)
AA seq 481 aa
MFVTAYLAFIVLAGLCVALEITARRLTLSQATQTAVANPAFQRFQKLFLKAYLLALWADW
LQGPYLYKLYRHYNFLESQIAILYVCGLASCVLFAPVAGWLPQFLGRRQTCLLFCLAYSV
CCITKLSQDYFMLILGRVLGGLSTSLLTTTFEAWYVHGHVDIHDFPKEWIPVTFGKVANW
NYGLAVGAGLVANLFAEWLGLGPVAPFLLAIPSLAACAWFVLSEWGQEDKQEGMNGDKNA
PLLNSLNTPKLQLSARARFWRSCVDGLRCLLSDRRVMLLGGVQALFESVLYIFVFLWTPV
LDPHGPPLGIVFSSLMAATMAGSTLFRLATSAPYRLQPGHLLCLAILLAFFSFFMLTFST
VPGQPRPRESLLAFLLLELACGLYFPAVSFLQGRVVPVERRAAVLAWFRLPLHLLACLGL
LALHGEVSGSGAGEAGSGTRHMFAGCAGMMLAALLAVISLFTVGRNDADLRLEGPKLEGE
I
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgtttgtgacggcatacctagcatttatagtcctagcaggactgtgtgtggctttagag
atcacagcccggcgtctcaccttatcccaggccacacagacagcagtcgccaatccggct
ttccagcgtttccagaagctctttctgaaggcgtatctcctggctctctgggcagactgg
ctacaagggccttacctttacaaactataccgacattacaacttcttggagtcacagatt
gccatcctatacgtctgcggtctggcttcttgtgtgctgtttgccccggtggccggatgg
ctgccacagtttctcggccgaagacagacgtgcctcctcttctgcttggcttattcagtg
tgttgcatcaccaaactctcacaagactattttatgctcattctaggacgtgtattaggc
ggcctgtccacttctctgctaacaaccacctttgaggcctggtatgtgcacggtcacgtt
gacatccatgacttccccaaagaatggatccctgttacgtttggtaaagtcgccaattgg
aattatggacttgcagttggtgctggactagtggcgaatttgttcgcagaatggcttggg
ttgggaccggtcgctccatttctgttggctatcccgagccttgctgcttgcgcctggttt
gtgctttccgaatggggtcaggaggacaaacaagaaggcatgaatggagacaaaaacgcc
ccccttcttaactccctaaacacccccaagttgcaattgtcagcacgtgcccgtttctgg
cgtagctgtgtggatggccttcgatgcctgctctcggaccgccgtgttatgcttttagga
ggcgttcaggcactttttgaaagcgtgctgtatatttttgtattcctgtggactcctgtt
ttggatcctcatggcccacctttaggaatcgtattctccagtttgatggcggccaccatg
gcgggctccacacttttccgattggccacatcagccccgtatcgactccaacccggtcat
ctgctctgcctagccattcttctagcgttcttctccttcttcatgctgacgttctccacc
gtgcctggccagccccggcccagggaatctctgctcgctttccttctgctggagctggct
tgtgggctttatttcccagcggtgagtttcctccagggtcgtgtggttcccgtggagcgc
agagctgcagttttggcttggtttcgtttgcctctgcacctcctggcctgtctggggctg
ctggcgcttcacggggaggtttcagggtccggtgcgggagaggctggcagcggcaccagg
cacatgtttgcaggctgtgctgggatgatgctggccgctctgctcgccgttatcagcctt
ttcactgtgggcaggaatgatgccgacctgagattagagggccccaaactggaaggagaa
atctga

DBGET integrated database retrieval system